StarFunc result for job id O95190

User Input

>input (189 residues)
MINTQDSSILPLSNCPQLQCCRHIVPGPLWCSDAPHPLSKIPGGRGGGRDPSLSALIYKD
EKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLL
ALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYP
LDQNLSDED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08608	0.770	0.770	7.573E-33	189	0.995	0.995	O08608.pdb.gz	OAZ2_MOUSE Ornithine decarboxylase antizyme 2 OS=Mus musculus OX=10090 GN=Oaz2 PE=1 SV=2
2	AFDB:P54368	0.704	0.589	8.768E-21	228	0.508	0.421	P54368.pdb.gz	OAZ1_HUMAN Ornithine decarboxylase antizyme 1 OS=Homo sapiens OX=9606 GN=OAZ1 PE=1 SV=3
3	AFDB:P54369	0.681	0.575	2.501E-20	227	0.508	0.423	P54369.pdb.gz	OAZ1_MOUSE Ornithine decarboxylase antizyme 1 OS=Mus musculus OX=10090 GN=Oaz1 PE=1 SV=3
4	AFDB:A1BPI0	0.688	0.543	3.609E-15	243	0.302	0.235	A1BPI0.pdb.gz	OAZ3_RAT Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1
5	AFDB:A8MW57	0.646	0.528	3.707E-14	235	0.291	0.234	A8MW57.pdb.gz	A8MW57_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
6	AFDB:P54361	0.507	0.386	8.042E-9	254	0.212	0.157	P54361.pdb.gz	OAZ_DROME Ornithine decarboxylase antizyme OS=Drosophila melanogaster OX=7227 GN=Oda PE=2 SV=2
7	AFDB:Q9USQ5	0.492	0.421	1.198E-4	226	0.153	0.128	Q9USQ5.pdb.gz	OAZ_SCHPO Ornithine decarboxylase antizyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spa1 PE=1 SV=2
8	PDB:5isvA	0.382	0.451	9.513E-4	156	0.138	0.167	5isvA.pdb.gz
9	PDB:3owcA	0.396	0.431	1.430E-3	172	0.069	0.076	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
10	PDB:4avaA	0.364	0.227	1.516E-3	327	0.069	0.040	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
11	PDB:4crzB	0.327	0.443	1.703E-3	128	0.095	0.141	4crzB.pdb.gz	The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
12	PDB:5c88A	0.295	0.343	1.913E-3	158	0.085	0.101	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
13	PDB:2g3aA	0.363	0.476	2.415E-3	137	0.095	0.131	2g3aA.pdb.gz
14	PDB:1tiqA	0.384	0.414	2.876E-3	173	0.101	0.110	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
15	AFDB:Q9FKI4	0.369	0.364	3.942E-3	192	0.095	0.094	Q9FKI4.pdb.gz	NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
16	PDB:6e1xC	0.384	0.408	4.079E-3	176	0.069	0.074	6e1xC.pdb.gz	Crystal structure of product-bound complex of spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae.
17	PDB:4ua3B	0.371	0.363	5.458E-3	194	0.079	0.077	4ua3B.pdb.gz	The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
18	PDB:6hd5u	0.307	0.255	5.785E-3	235	0.116	0.094	6hd5u.pdb.gz
19	AFDB:Q9S720	0.131	0.107	8.405E-3	247	0.143	0.109	Q9S720.pdb.gz	PPD3_ARATH PsbP domain-containing protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPD3 PE=1 SV=2
20	AFDB:Q9C7G6	0.366	0.284	1.505E-2	256	0.090	0.066	Q9C7G6.pdb.gz	GNT10_ARATH GCN5-related N-acetyltransferase 10, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GNAT10 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95190	6.12e-140	389	189	1.000	1.000	OAZ2_HUMAN Ornithine decarboxylase antizyme 2 OS=Homo sapiens OX=9606 GN=OAZ2 PE=1 SV=1
2	O08608	4.82e-139	387	189	0.995	0.995	OAZ2_MOUSE Ornithine decarboxylase antizyme 2 OS=Mus musculus OX=10090 GN=Oaz2 PE=1 SV=2
3	P54369	4.83e-63	196	227	0.508	0.423	OAZ1_MOUSE Ornithine decarboxylase antizyme 1 OS=Mus musculus OX=10090 GN=Oaz1 PE=1 SV=3
4	P54368	1.18e-62	195	228	0.513	0.425	OAZ1_HUMAN Ornithine decarboxylase antizyme 1 OS=Homo sapiens OX=9606 GN=OAZ1 PE=1 SV=3
5	P54370	2.03e-62	194	227	0.503	0.419	OAZ1_RAT Ornithine decarboxylase antizyme 1 OS=Rattus norvegicus OX=10116 GN=Oaz1 PE=1 SV=3
6	A1BPI0	1.89e-29	110	243	0.317	0.247	OAZ3_RAT Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1
7	Q9R109	8.59e-29	108	243	0.312	0.243	OAZ3_MOUSE Ornithine decarboxylase antizyme 3 OS=Mus musculus OX=10090 GN=Oaz3 PE=1 SV=2
8	H0Y7Y4	8.72e-29	108	203	0.312	0.291	H0Y7Y4_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
9	A0A0G2JH29	9.35e-29	107	190	0.270	0.268	A0A0G2JH29_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
10	A8MW57	2.90e-28	107	235	0.312	0.251	A8MW57_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
11	Q9UMX2	2.90e-28	107	235	0.312	0.251	OAZ3_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
12	J3QLT2	3.52e-26	99.0	123	0.228	0.350	J3QLT2_HUMAN Ornithine decarboxylase antizyme 3 (Fragment) OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
13	P54361	1.64e-12	65.9	254	0.206	0.154	OAZ_DROME Ornithine decarboxylase antizyme OS=Drosophila melanogaster OX=7227 GN=Oda PE=2 SV=2
14	H2ELN1	1.1	32.3	522	0.074	0.027	TER_NICLA Terpineol synthase, chloroplastic (Fragment) OS=Nicotiana langsdorffii OX=118700 GN=TER PE=1 SV=1
15	H6WZF2	1.1	32.3	543	0.074	0.026	TER_NICAL Terpineol synthase, chloroplastic OS=Nicotiana alata OX=4087 GN=TER PE=1 SV=1
16	A1Z8G0	2.8	30.8	595	0.122	0.039	A1Z8G0_DROME Menage a trois, isoform A OS=Drosophila melanogaster OX=7227 GN=metro PE=1 SV=1
17	B7YZF0	2.9	30.8	585	0.122	0.039	B7YZF0_DROME Menage a trois, isoform C OS=Drosophila melanogaster OX=7227 GN=metro PE=1 SV=1
18	Q8T5S9	3.8	30.4	556	0.122	0.041	Q8T5S9_DROME GH12103p OS=Drosophila melanogaster OX=7227 GN=metro PE=1 SV=1
19	A0A0B4LF49	4.3	30.4	546	0.122	0.042	A0A0B4LF49_DROME Menage a trois, isoform D OS=Drosophila melanogaster OX=7227 GN=metro PE=1 SV=1
20	O55126	6.2	29.6	281	0.127	0.085	NIPS2_MOUSE Protein NipSnap homolog 2 OS=Mus musculus OX=10090 GN=Nipsnap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02100 ODC_AZ	5.5e-16	70.0	Ornithine decarboxylase antizyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008566186.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008574311.1	0.904	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 22 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008582448.1	0.898	Spermidine synthase-like
3	482537.XP_008583668.1	0.898	Spermidine synthase
4	482537.XP_008582547.1	0.895	Ornithine decarboxylase
5	482537.XP_008584570.1	0.842	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008583880.1	0.753	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008580238.1	0.704	26S proteasome non-ATPase regulatory subunit 3
8	482537.XP_008573365.1	0.691	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
9	482537.XP_008579028.1	0.688	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
10	482537.XP_008564686.1	0.681	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008564715.1	0.675	Proteasome subunit alpha type-5
12	482537.XP_008565164.1	0.674	26S protease regulatory subunit 10B
13	482537.XP_008584801.1	0.672	26S proteasome non-ATPase regulatory subunit 13
14	482537.XP_008570560.1	0.671	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 mRNAs, 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
15	482537.XP_008580502.1	0.671	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 mRNAs, 22 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	482537.XP_008579048.1	0.667	Proteasome subunit beta type-3
17	482537.XP_008566117.1	0.666	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 18 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
18	482537.XP_008566239.1	0.666	Proteasome subunit beta type-7
19	482537.XP_008572173.1	0.666	26S proteasome non-ATPase regulatory subunit 8
20	482537.XP_008572919.1	0.666	26S protease regulatory subunit 6A-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008073	1.000	ornithine decarboxylase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006576	0.996	biogenic amine metabolic process
GO:0006595	0.994	polyamine metabolic process
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0080090	0.935	regulation of primary metabolic process
GO:0009894	0.883	regulation of catabolic process
GO:0051246	0.879	regulation of protein metabolic process
GO:0042176	0.828	regulation of protein catabolic process
GO:0050794	0.762	regulation of cellular process
GO:0048518	0.702	positive regulation of biological process
GO:0010604	0.596	positive regulation of macromolecule metabolic process
GO:0051173	0.567	positive regulation of nitrogen compound metabolic process
GO:0048519	0.514	negative regulation of biological process
GO:0051247	0.362	positive regulation of protein metabolic process
GO:0045732	0.343	positive regulation of protein catabolic process
GO:0009987	0.335	cellular process
GO:0048522	0.332	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005654	0.948	nucleoplasm
GO:0032991	0.488	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]