StarFunc result for job id O95197

User Input

>input (1032 residues)
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVS
LFSTSQEGLSSLCSDEPSSEIMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKD
HLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQI
DKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLSPSKVSGDDVIE
KDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTDKESSEDISETNDKLFPLRNK
EAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQQTDKSSDCIT
KTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKP
VPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDE
MDWQSSALGEITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIK
EIPSCEREEKTSKNFEELVSDSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAP
EKPITTENPKLPSTVSPNVFNETEFSLNVTTSAYLESLHGKNVKHIDDSSPEDLIAAFTE
TRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNGS
EPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPSEEVLKQTFTF
APESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLT
DFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVI
QAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKL
AVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQ
AKLPGIAKKKAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95197	1.000	1.000	0.000	1032	1.000	1.000	O95197.pdb.gz	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
2	AFDB:Q9ES97	0.260	0.275	4.111E-81	964	0.661	0.707	Q9ES97.pdb.gz	RTN3_MOUSE Reticulon-3 OS=Mus musculus OX=10090 GN=Rtn3 PE=1 SV=2
3	AFDB:Q6RJR6	0.129	0.139	1.231E-67	940	0.613	0.673	Q6RJR6.pdb.gz	RTN3_RAT Reticulon-3 OS=Rattus norvegicus OX=10116 GN=Rtn3 PE=1 SV=1
4	AFDB:Q9NQC3	0.092	0.081	2.525E-18	1192	0.255	0.221	Q9NQC3.pdb.gz	RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2
5	AFDB:Q9JK11	0.103	0.094	7.716E-17	1163	0.234	0.207	Q9JK11.pdb.gz	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
6	AFDB:B9G5N1	0.041	0.048	2.683E-4	844	0.113	0.139	B9G5N1.pdb.gz	PAIR3_ORYSJ Meiosis-specific protein PAIR3 OS=Oryza sativa subsp. japonica OX=39947 GN=PAIR3 PE=2 SV=1
7	AFDB:Q5EXX3	0.044	0.039	4.743E-4	1203	0.115	0.099	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
8	AFDB:O70608	0.047	0.036	1.081E-3	1505	0.157	0.108	O70608.pdb.gz	SYCP2_RAT Synaptonemal complex protein 2 OS=Rattus norvegicus OX=10116 GN=Sycp2 PE=1 SV=1
9	AFDB:Q9Y6A5	0.045	0.052	1.392E-3	838	0.121	0.149	Q9Y6A5.pdb.gz	TACC3_HUMAN Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1
10	AFDB:O01585	0.054	0.052	1.793E-3	1085	0.113	0.108	O01585.pdb.gz	O01585_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-3 PE=1 SV=1
11	PDB:6id0L	0.043	0.081	1.631	475	0.041	0.088	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
12	PDB:6iczL	0.043	0.084	3.488	454	0.037	0.084	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:5gm6c	0.046	0.085	5.100	415	0.035	0.087	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:5datSM	0.038	0.167	6.570	159	0.017	0.113	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
15	PDB:6qdvO	0.036	0.077	7.457	441	0.037	0.086	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95197	0.0	2104	1032	1.000	1.000	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
2	Q6RJR6	0.0	1106	940	0.620	0.681	RTN3_RAT Reticulon-3 OS=Rattus norvegicus OX=10116 GN=Rtn3 PE=1 SV=1
3	Q9ES97	0.0	1159	964	0.667	0.714	RTN3_MOUSE Reticulon-3 OS=Mus musculus OX=10090 GN=Rtn3 PE=1 SV=2
4	F1QT89	8.56e-74	244	196	0.110	0.582	F1QT89_DANRE Reticulon OS=Danio rerio OX=7955 GN=Nogo-B PE=1 SV=1
5	Q99P72	1.97e-73	267	1162	0.114	0.102	RTN4_MOUSE Reticulon-4 OS=Mus musculus OX=10090 GN=Rtn4 PE=1 SV=2
6	Q9JK11	2.78e-73	266	1163	0.111	0.099	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
7	Q4G5W2	7.41e-73	246	322	0.110	0.354	Q4G5W2_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
8	Q9NQC3	7.87e-73	265	1192	0.113	0.098	RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2
9	Q4G5V9	6.59e-72	239	212	0.110	0.538	Q4G5V9_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
10	Q6IFY7	1.49e-69	233	207	0.108	0.536	RTN1A_XENLA Reticulon-1-A OS=Xenopus laevis OX=8355 GN=rtn1-a PE=2 SV=1
11	Q64548	1.07e-62	230	777	0.108	0.143	RTN1_RAT Reticulon-1 OS=Rattus norvegicus OX=10116 GN=Rtn1 PE=1 SV=1
12	Q8K0T0	1.30e-62	230	780	0.108	0.142	RTN1_MOUSE Reticulon-1 OS=Mus musculus OX=10090 GN=Rtn1 PE=1 SV=1
13	Q2NKQ5	1.53e-62	228	702	0.109	0.160	Q2NKQ5_HUMAN Reticulon OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
14	Q16799	2.70e-62	229	776	0.109	0.144	RTN1_HUMAN Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
15	Q9VMW4	1.27e-56	197	222	0.096	0.446	Q9VMW4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
16	Q7KTP4	5.38e-56	196	234	0.096	0.423	Q7KTP4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
17	Q9VMW1	7.29e-56	195	224	0.096	0.442	Q9VMW1_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=2
18	Q9VMV9	1.25e-55	206	595	0.096	0.166	Q9VMV9_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=2
19	E1JHT9	1.47e-55	194	222	0.095	0.441	E1JHT9_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=2
20	E1JHT6	1.73e-55	206	607	0.096	0.163	E1JHT6_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02453 Reticulon	6.7e-39	144.9	Reticulon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318585	0.974	Beta-secretase 1
2	9606.ENSP00000337838	0.960	Reticulon-4
3	9606.ENSP00000332979	0.943	Beta-secretase 2
4	9606.ENSP00000368959	0.788	Receptor expression-enhancing protein 5
5	9606.ENSP00000381844	0.709	Atlastin-3
6	9606.ENSP00000304642	0.705	Reticulophagy regulator 1
7	9606.ENSP00000337688	0.675	Translocation protein SEC62
8	9606.ENSP00000403400	0.670	Cell cycle progression protein 1
9	9606.ENSP00000345985	0.667	Leucine-rich repeat and fibronectin type-III domain-containing protein 2
10	9606.ENSP00000396628	0.650	Testis-expressed protein 264
11	9606.ENSP00000351155	0.640	Atlastin-1
12	9606.ENSP00000357480	0.630	Dehydrodolichyl diphosphate synthase complex subunit NUS1
13	9606.ENSP00000248668	0.629	Leucine-rich repeat and fibronectin type III domain-containing protein 1
14	9606.ENSP00000312535	0.623	Leucine-rich repeat and fibronectin type-III domain-containing protein 4
15	9606.ENSP00000466989	0.623	Leucine-rich repeat and fibronectin type-III domain-containing protein 3
16	9606.ENSP00000345656	0.622	Vesicle-associated membrane protein-associated protein A
17	9606.ENSP00000222008	0.617	Prenylated Rab acceptor protein 1
18	9606.ENSP00000438346	0.591	Receptor expression-enhancing protein 1
19	9606.ENSP00000233596	0.556	Receptor accessory protein 6
20	9606.ENSP00000422473	0.556	Transmembrane protein 33

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.992	regulation of biological process
GO:0016043	0.991	cellular component organization
GO:0019222	0.974	regulation of metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0010256	0.951	endomembrane system organization
GO:0006996	0.937	organelle organization
GO:0007029	0.934	endoplasmic reticulum organization
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0048519	0.892	negative regulation of biological process
GO:0051246	0.835	regulation of protein metabolic process
GO:1902991	0.791	regulation of amyloid precursor protein catabolic process
GO:0044085	0.747	cellular component biogenesis
GO:0022607	0.715	cellular component assembly
GO:0009892	0.522	negative regulation of metabolic process
GO:0050794	0.495	regulation of cellular process
GO:0034248	0.464	regulation of amide metabolic process
GO:0051172	0.449	negative regulation of nitrogen compound metabolic process
GO:0010605	0.324	negative regulation of macromolecule metabolic process
GO:1902003	0.316	regulation of amyloid-beta formation
GO:0034249	0.315	negative regulation of amide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.997	intracellular organelle
GO:0005737	0.993	cytoplasm
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005886	0.987	plasma membrane
GO:0005576	0.969	extracellular region
GO:0031090	0.952	organelle membrane
GO:0005783	0.941	endoplasmic reticulum
GO:0005794	0.924	Golgi apparatus
GO:0098827	0.907	endoplasmic reticulum subcompartment
GO:0005789	0.903	endoplasmic reticulum membrane
GO:0005615	0.693	extracellular space
GO:0043233	0.465	organelle lumen
GO:0030054	0.451	cell junction
GO:0070013	0.442	intracellular organelle lumen
GO:0032991	0.329	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]