StarFunc result for job id O95202

User Input

>input (739 residues)
MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHP
VYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVV
EKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAAR
MLWRILNGHSLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTF
ETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSATKDFSVFFQKIRETGERP
SNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDK
LIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEH
REKELQKRSEVAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEI
TKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVE
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQV
KHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLEKEEKV
EEKEKAKEKAEKEVAEVKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95202	1.000	1.000	7.126E-92	739	1.000	1.000	O95202.pdb.gz	LETM1_HUMAN Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1
2	AFDB:Q9Z2I0	0.606	0.607	7.790E-70	738	0.838	0.839	Q9Z2I0.pdb.gz	LETM1_MOUSE Mitochondrial proton/calcium exchanger protein OS=Mus musculus OX=10090 GN=Letm1 PE=1 SV=1
3	AFDB:P91927	0.317	0.234	5.581E-31	1013	0.352	0.257	P91927.pdb.gz	LETM1_DROME Mitochondrial proton/calcium exchanger protein OS=Drosophila melanogaster OX=7227 GN=Letm1 PE=2 SV=2
4	AFDB:F4J9G6	0.420	0.409	1.314E-24	760	0.286	0.278	F4J9G6.pdb.gz	F4J9G6_ARATH Mitochondrial proton/calcium exchanger protein OS=Arabidopsis thaliana OX=3702 GN=LETM1 PE=1 SV=1
5	AFDB:A0A1D8PCG9	0.324	0.457	2.293E-19	508	0.212	0.309	A0A1D8PCG9.pdb.gz	A0A1D8PCG9_CANAL Mrs7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MRS7 PE=4 SV=1
6	AFDB:Q06493	0.320	0.503	9.936E-18	454	0.187	0.304	Q06493.pdb.gz	YLH47_YEAST LETM1 domain-containing protein YLH47, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLH47 PE=1 SV=1
7	AFDB:Q924L1	0.296	0.549	2.205E-10	360	0.092	0.189	Q924L1.pdb.gz	LTMD1_MOUSE LETM1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Letmd1 PE=1 SV=1
8	PDB:8ap7E	0.233	0.387	2.106E-4	383	0.081	0.157	8ap7E.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
9	AFDB:Q9VDG2	0.086	0.099	2.857E-3	625	0.106	0.125	Q9VDG2.pdb.gz	RLIP_DROME RalA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Rlip PE=1 SV=1
10	AFDB:A2BEV6	0.066	0.059	1.374E-2	861	0.143	0.123	A2BEV6.pdb.gz	A2BEV6_DANRE Nexilin OS=Danio rerio OX=7955 GN=CH211-232D19.9 PE=4 SV=2
11	AFDB:Q8RWG2	0.071	0.076	2.461E-2	652	0.103	0.117	Q8RWG2.pdb.gz	CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana OX=3702 GN=HCF107 PE=1 SV=1
12	PDB:1sjjA	0.085	0.075	3.305E-1	863	0.112	0.096	1sjjA.pdb.gz
13	PDB:7pntV	0.075	0.122	4.525E-1	365	0.085	0.173	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:6lfmR	0.073	0.145	4.949E-1	307	0.065	0.156	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
15	PDB:7wtww	0.070	0.114	5.662E-1	332	0.057	0.127	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
16	PDB:2n6aA	0.070	0.272	5.922E-1	162	0.016	0.074	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein
17	PDB:7eebB	0.063	0.134	8.480E-1	281	0.069	0.181	7eebB.pdb.gz	Structure of a mammalian sperm cation channel complex.
18	PDB:5wlcST	0.063	0.072	9.702E-1	599	0.078	0.097	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
19	PDB:7l08AV	0.070	0.107	1.061	367	0.093	0.188	7l08AV.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
20	PDB:7d5sRN	0.070	0.078	1.110	607	0.092	0.112	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95202	0.0	1500	739	1.000	1.000	LETM1_HUMAN Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1
2	Q9Z2I0	0.0	1144	738	0.809	0.810	LETM1_MOUSE Mitochondrial proton/calcium exchanger protein OS=Mus musculus OX=10090 GN=Letm1 PE=1 SV=1
3	P91927	1.44e-134	424	1013	0.332	0.242	LETM1_DROME Mitochondrial proton/calcium exchanger protein OS=Drosophila melanogaster OX=7227 GN=Letm1 PE=2 SV=2
4	F4IBH5	2.35e-88	295	736	0.204	0.205	F4IBH5_ARATH Mitochondrial proton/calcium exchanger protein OS=Arabidopsis thaliana OX=3702 GN=LETM2 PE=1 SV=1
5	F4J9G6	2.46e-88	295	760	0.199	0.193	F4J9G6_ARATH Mitochondrial proton/calcium exchanger protein OS=Arabidopsis thaliana OX=3702 GN=LETM1 PE=1 SV=1
6	A0A1D8PCG9	1.45e-69	238	508	0.177	0.258	A0A1D8PCG9_CANAL Mrs7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MRS7 PE=4 SV=1
7	O13920	3.80e-66	229	485	0.183	0.278	MDM28_SCHPO LETM1 domain-containing protein mdm28, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdm28 PE=2 SV=3
8	Q08179	1.24e-63	224	573	0.177	0.229	MDM38_YEAST Mitochondrial distribution and morphology protein 38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM38 PE=1 SV=1
9	Q06493	2.65e-56	201	454	0.162	0.264	YLH47_YEAST LETM1 domain-containing protein YLH47, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLH47 PE=1 SV=1
10	A0A384P5D7	2.12e-09	62.4	360	0.083	0.169	A0A384P5D7_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
11	Q6P1Q0	2.12e-09	62.4	360	0.083	0.169	LTMD1_HUMAN LETM1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LETMD1 PE=1 SV=1
12	Q924L1	2.06e-07	56.2	360	0.084	0.172	LTMD1_MOUSE LETM1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Letmd1 PE=1 SV=1
13	F8VZA2	2.73e-07	55.1	290	0.078	0.200	F8VZA2_HUMAN LETM1 domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=LETMD1 PE=1 SV=8
14	F8VP71	1.50e-06	52.4	243	0.047	0.144	F8VP71_HUMAN LETM1 domain containing 1 OS=Homo sapiens OX=9606 GN=LETMD1 PE=1 SV=1
15	Q8H0W4	1.18e-04	48.1	872	0.041	0.034	Q8H0W4_ARATH AT3G11560 protein OS=Arabidopsis thaliana OX=3702 GN=At3g11560 PE=1 SV=1
16	C9ZLK0	1.57e-04	47.0	377	0.070	0.138	C9ZLK0_TRYB9 Letm1 RBD domain-containing protein OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) OX=679716 GN=TbgDal_III5510 PE=4 SV=1
17	Q9VZ77	0.014	41.6	4385	0.050	0.008	Q9VZ77_DROME Dynein, axonemal, heavy chain 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Dnah3 PE=3 SV=3
18	Q9JM83	0.023	38.5	148	0.027	0.135	CALM4_MOUSE Calmodulin-4 OS=Mus musculus OX=10090 GN=Calm4 PE=2 SV=2
19	E9PSL7	0.063	39.3	2055	0.088	0.032	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
20	P49025	0.23	37.4	2055	0.087	0.031	CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus OX=10090 GN=Cit PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13720 Acetyltransf_11	36	16.2	Udp N-acetylglucosamine O-acyltransferase; Domain 2
2	PF10691 DUF2497	1.3e+02	14.5	Protein of unknown function (DUF2497)
3	PF14233 DUF4335	1e+02	14.2	Domain of unknown function (DUF4335)
4	PF00036 EF-hand_1	26	15.7	EF hand
5	PF13405 EF-hand_6	21	16.3	EF-hand domain
6	PF13833 EF-hand_8	0.55	21.4	EF-hand domain pair
7	PF07766 LETM1_RBD	6e-87	302.5	LETM1-like, RBD
8	PF02037 SAP	5.4e+02	11.8	SAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305653

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357804	0.889	Acyl-coenzyme A thioesterase THEM4
2	9606.ENSP00000354415	0.872	Calcium uptake protein 1, mitochondrial
3	9606.ENSP00000362144	0.856	Calcium uniporter protein, mitochondrial
4	9606.ENSP00000447091	0.828	Mitochondrial sodium/calcium exchanger protein
5	9606.ENSP00000372335	0.827	Negative elongation factor A
6	9606.ENSP00000291574	0.825	Trafficking protein particle complex subunit 10
7	9606.ENSP00000368468	0.777	Mitochondrial calcium uniporter regulator 1
8	9606.ENSP00000372351	0.749	Histone-lysine N-methyltransferase NSD2
9	9606.ENSP00000415203	0.746	GPI ethanolamine phosphate transferase 2
10	9606.ENSP00000371811	0.743	Calcium uptake protein 2, mitochondrial
11	9606.ENSP00000423399	0.733	Mitochondrial ribosomal protein L36
12	9606.ENSP00000378145	0.721	Calcium uniporter regulatory subunit MCUb, mitochondrial
13	9606.ENSP00000483491	0.715	Mitochondrial inner membrane protein OXA1L
14	9606.ENSP00000272321	0.680	WD repeat-containing and planar cell polarity effector protein fritz homolog
15	9606.ENSP00000475489	0.676	M-phase phosphoprotein 9
16	9606.ENSP00000227266	0.612	Dipeptidyl peptidase 1
17	9606.ENSP00000339381	0.605	Regulator of G-protein signaling 12
18	9606.ENSP00000321455	0.588	Calcium uptake protein 3, mitochondrial
19	9606.ENSP00000216034	0.580	Mitochondrial import receptor subunit TOM22 homolog
20	9606.ENSP00000326550	0.577	Transforming acidic coiled-coil-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015369	1.000	calcium:proton antiporter activity
GO:0005515	0.999	protein binding
GO:0043167	0.997	ion binding
GO:0005509	0.992	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0048878	0.982	chemical homeostasis
GO:1990542	0.981	mitochondrial transmembrane transport
GO:0070588	0.980	calcium ion transmembrane transport
GO:0051560	0.972	mitochondrial calcium ion homeostasis
GO:0051282	0.956	regulation of sequestering of calcium ion
GO:0051283	0.941	negative regulation of sequestering of calcium ion
GO:0071840	0.866	cellular component organization or biogenesis
GO:0097553	0.850	calcium ion transmembrane import into cytosol
GO:0016043	0.845	cellular component organization
GO:0051209	0.841	release of sequestered calcium ion into cytosol
GO:0006996	0.754	organelle organization
GO:0048583	0.725	regulation of response to stimulus
GO:0007005	0.481	mitochondrion organization
GO:0080134	0.326	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:0032991	0.768	protein-containing complex
GO:0070013	0.324	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:71799	1.000	Ca(2+)(in) + H(+)(out) = Ca(2+)(out) + H(+)(in)

[back to server]