StarFunc result for job id O95206

User Input

>input (1070 residues)
MSPVRRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGD
TSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
VEVEVRDVNDHAPRFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQTVRLAEPHSP
FRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDAND
HSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFAFGARTPPEARRLFRLD
PRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDNAPDIAITPLA
APGAPATSPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRD
SGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTV
RPYTVRVGDENDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAE
VGRAGGAVSTYVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVL
DQNDHAPVLVHPAPANGSLEVAVPGRTAKDTVVARVQARDADEGANGELAFELQQQEPRE
AFAIGRRTGEILLTGDLSQEPPGRVFRALLVISDGGRPPLTTTATVSFVVTAGGGRGPAA
PASAGSPERSRPPGSRLGVSGSVLQWDTPLIVIIVLAGSCTLLLAAIIAIATTCNRRKKE
VRKGGALREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGTGKAPFGSPAADAP
PPAVAAAEVPGSEGGSATGESACHFEGQQRLRGAHAEPYGASPGFGKEPAPPVAVWKGHS
FNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGH
SDRCWSPSCSGPNAHPSPHPPAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEK
VLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRYLSPKKGANENV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95206	1.000	1.000	0.000	1070	1.000	1.000	O95206.pdb.gz	PCDH8_HUMAN Protocadherin-8 OS=Homo sapiens OX=9606 GN=PCDH8 PE=1 SV=2
2	AFDB:Q9HCL0	0.588	0.556	1.951E-93	1135	0.344	0.324	Q9HCL0.pdb.gz	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
3	AFDB:F1QRP2	0.519	0.492	1.581E-92	1135	0.335	0.315	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
4	AFDB:A0A2R8RMH2	0.587	0.547	2.005E-91	1150	0.339	0.316	A0A2R8RMH2.pdb.gz
5	AFDB:O14917	0.515	0.478	6.094E-88	1159	0.332	0.306	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
6	AFDB:C4P342	0.548	0.517	2.715E-87	1137	0.321	0.302	C4P342.pdb.gz	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
7	AFDB:A0A2R8QME5	0.555	0.543	4.204E-86	1094	0.312	0.305	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
8	AFDB:F7BJK1	0.393	0.391	5.957E-64	1077	0.254	0.253	F7BJK1.pdb.gz	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1
9	AFDB:P13590	0.148	0.146	7.557E-19	1091	0.130	0.127	P13590.pdb.gz	NCAM1_CHICK Neural cell adhesion molecule 1 OS=Gallus gallus OX=9031 GN=NCAM1 PE=1 SV=3
10	AFDB:Q05BQ1	0.139	0.130	9.223E-19	1179	0.155	0.141	Q05BQ1.pdb.gz	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
11	PDB:4aq1A	0.102	0.141	5.162E-14	721	0.086	0.128	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:6velC	0.158	0.727	6.961E-14	209	0.049	0.249	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:7sqcO0	0.123	0.118	1.793E-13	1140	0.109	0.103	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:1e07A	0.133	0.177	5.513E-11	642	0.060	0.100	1e07A.pdb.gz
15	PDB:5oj2B	0.122	0.172	6.728E-11	692	0.080	0.124	5oj2B.pdb.gz
16	PDB:7vonA	0.087	0.071	3.081E-8	1399	0.056	0.043	7vonA.pdb.gz
17	PDB:4rtdA	0.076	0.073	4.154E-8	1122	0.065	0.062	4rtdA.pdb.gz
18	PDB:5a42A	0.077	0.058	8.343E-8	1597	0.098	0.066	5a42A.pdb.gz
19	PDB:6dldD	0.121	0.332	6.759E-7	269	0.037	0.149	6dldD.pdb.gz
20	PDB:7q1yA	0.080	0.066	3.012E-6	1374	0.079	0.061	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9CPE6	0.0	603	1150	0.350	0.326	A9CPE6_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh 18 PE=2 SV=2
2	A9QUV5	0.0	602	1123	0.331	0.315	A9QUV5_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh18 PE=2 SV=1
3	B5TR11	0.0	672	979	0.334	0.365	B5TR11_XENLA Paraxial protocadherin OS=Xenopus laevis OX=8355 GN=PAPC PE=1 SV=1
4	D3ZE55	0.0	1857	1069	0.948	0.949	PCDH8_RAT Protocadherin-8 OS=Rattus norvegicus OX=10116 GN=Pcdh8 PE=1 SV=2
5	F1QRP2	0.0	592	1135	0.327	0.308	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
6	O93509	0.0	668	979	0.327	0.358	O93509_XENLA Paraxial protocadherin OS=Xenopus laevis OX=8355 PE=2 SV=1
7	O95206	0.0	2144	1070	1.000	1.000	PCDH8_HUMAN Protocadherin-8 OS=Homo sapiens OX=9606 GN=PCDH8 PE=1 SV=2
8	Q7TSK3	0.0	1845	1070	0.942	0.942	PCDH8_MOUSE Protocadherin-8 OS=Mus musculus OX=10090 GN=Pcdh8 PE=1 SV=1
9	Q8VHR0	0.0	577	1134	0.286	0.270	PCD18_MOUSE Protocadherin 18 OS=Mus musculus OX=10090 GN=Pcdh18 PE=1 SV=2
10	Q9HCL0	0.0	614	1135	0.333	0.314	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
11	Q805F0	2.79e-174	540	1026	0.326	0.340	Q805F0_DANRE Protocadherin 10 OS=Danio rerio OX=7955 GN=pcdh10 PE=2 SV=1
12	Q6NYV7	2.16e-172	534	1001	0.317	0.339	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
13	A0A2R8QI99	3.66e-172	533	997	0.317	0.340	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
14	E9PXQ7	4.12e-169	527	1057	0.347	0.351	E9PXQ7_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
15	Q80TE2	5.28e-169	528	1098	0.351	0.342	Q80TE2_MOUSE MKIAA1400 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
16	C4P342	3.81e-165	519	1137	0.313	0.295	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
17	Q9Z1B1	1.46e-159	497	896	0.296	0.354	Q9Z1B1_MOUSE OL-protocadherin OS=Mus musculus OX=10090 GN=Pcdh10 PE=2 SV=1
18	Q6P0A6	1.51e-159	497	896	0.296	0.354	Q6P0A6_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
19	Q925I8	8.73e-159	499	1040	0.337	0.347	Q925I8_MOUSE OL-protocadherin isoform OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
20	E9PX28	1.31e-158	499	1047	0.337	0.345	E9PX28_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	4.2e-78	269.2	Cadherin domain
2	PF08266 Cadherin_2	5e-13	60.0	Cadherin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367177

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320081	0.721	Deleted in autism protein 1
2	9606.ENSP00000304331	0.658	GS homeobox 1
3	9606.ENSP00000368716	0.626	N-alpha-acetyltransferase 16, NatA auxiliary subunit
4	9606.ENSP00000368698	0.594	Zinc finger protein 40
5	9606.ENSP00000242839	0.574	Copper-transporting ATPase 2
6	9606.ENSP00000238714	0.548	Poly(A) polymerase gamma
7	9606.ENSP00000222812	0.543	Syntaxin-1A
8	9606.ENSP00000376178	0.528	Syntaxin-2
9	9606.ENSP00000440190	0.514	Tudor domain-containing protein 3
10	9606.ENSP00000367075	0.512	Kelch-like protein 1
11	9606.ENSP00000368612	0.510	Von Willebrand factor A domain-containing protein 8
12	9606.ENSP00000286201	0.509	Frizzled-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.755	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.889	biological regulation
GO:0050794	0.862	regulation of cellular process
GO:0007154	0.847	cell communication
GO:0023052	0.811	signaling
GO:0007267	0.747	cell-cell signaling
GO:0032501	0.606	multicellular organismal process
GO:0048856	0.593	anatomical structure development
GO:0007275	0.539	multicellular organism development
GO:0050896	0.415	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.464	organelle
GO:0043227	0.407	membrane-bounded organelle
GO:0005622	0.382	intracellular anatomical structure
GO:0043231	0.363	intracellular membrane-bounded organelle
GO:0005737	0.326	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]