StarFunc result for job id O95214

User Input

>input (131 residues)
MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD
AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF
GSNDDFSWQQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95214	1.000	1.000	2.360E-19	131	1.000	1.000	O95214.pdb.gz	LERL1_HUMAN Leptin receptor overlapping transcript-like 1 OS=Homo sapiens OX=9606 GN=LEPROTL1 PE=1 SV=2
2	AFDB:O15243	0.947	0.947	8.760E-15	131	0.679	0.679	O15243.pdb.gz	OBRG_HUMAN Leptin receptor gene-related protein OS=Homo sapiens OX=9606 GN=LEPROT PE=1 SV=1
3	AFDB:P47111	0.782	0.737	6.686E-6	140	0.336	0.314	P47111.pdb.gz	VPS55_YEAST Vacuolar protein sorting-associated protein 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS55 PE=1 SV=1
4	AFDB:Q9UUH1	0.856	0.874	1.854E-5	128	0.244	0.250	Q9UUH1.pdb.gz	VPS55_SCHPO Vacuolar protein sorting-associated protein 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps55 PE=3 SV=2
5	AFDB:Q9AST6	0.739	0.696	3.006E-5	140	0.267	0.250	Q9AST6.pdb.gz	VSP55_ARATH Vacuolar protein sorting-associated protein 55 homolog OS=Arabidopsis thaliana OX=3702 GN=At1g32410 PE=2 SV=1
6	AFDB:F4J6B8	0.620	0.705	6.075E-4	113	0.214	0.248	F4J6B8.pdb.gz	F4J6B8_ARATH Vacuolar protein sorting 55 (VPS55) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g11530 PE=1 SV=1
7	AFDB:Q12016	0.654	0.494	1.704E-1	184	0.145	0.103	Q12016.pdb.gz	VPS68_YEAST Vacuolar protein sorting-associated protein 68 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS68 PE=1 SV=1
8	AFDB:O43073	0.630	0.514	2.002E-1	170	0.145	0.112	O43073.pdb.gz	YGW2_SCHPO UPF0220 protein C8D2.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi063 PE=3 SV=1
9	AFDB:P56557	0.551	0.478	2.618E-1	158	0.076	0.063	P56557.pdb.gz	TM50B_HUMAN Transmembrane protein 50B OS=Homo sapiens OX=9606 GN=TMEM50B PE=1 SV=2
10	AFDB:P53209	0.403	0.302	4.987E-1	190	0.145	0.100	P53209.pdb.gz	YG1A_YEAST Uncharacterized membrane protein YGR016W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR016W PE=1 SV=1
11	PDB:7q83D	0.391	0.347	6.361E-1	156	0.069	0.058	7q83D.pdb.gz
12	PDB:4q4aA	0.299	0.115	6.711E-1	572	0.137	0.031	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
13	PDB:7td3R	0.331	0.178	7.472E-1	292	0.099	0.045	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
14	PDB:7finR	0.369	0.160	9.262E-1	380	0.145	0.050	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
15	PDB:6zfzA	0.284	0.123	1.088	446	0.183	0.054	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.
16	PDB:7nsuD	0.352	0.137	1.423	420	0.084	0.026	7nsuD.pdb.gz
17	PDB:7x5hR	0.321	0.177	1.423	274	0.160	0.077	7x5hR.pdb.gz	Structural insights into the ligand binding and G i coupling of serotonin receptor 5-HT 5A .
18	PDB:7ocaG	0.257	0.226	1.672	158	0.130	0.108	7ocaG.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
19	PDB:7w56R	0.274	0.158	1.672	276	0.092	0.043	7w56R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
20	PDB:7vqxR	0.300	0.131	1.861	361	0.153	0.055	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95214	5.07e-92	263	131	1.000	1.000	LERL1_HUMAN Leptin receptor overlapping transcript-like 1 OS=Homo sapiens OX=9606 GN=LEPROTL1 PE=1 SV=2
2	Q6FHL7	5.07e-92	263	131	1.000	1.000	Q6FHL7_HUMAN LEPROTL1 protein OS=Homo sapiens OX=9606 GN=LEPROTL1 PE=1 SV=1
3	Q6PDU4	3.58e-91	261	131	0.977	0.977	LERL1_RAT Leptin receptor overlapping transcript-like 1 OS=Rattus norvegicus OX=10116 GN=Leprotl1 PE=1 SV=1
4	O89013	2.79e-65	196	131	0.718	0.718	OBRG_MOUSE Leptin receptor gene-related protein OS=Mus musculus OX=10090 GN=Leprot PE=1 SV=1
5	O15243	3.21e-62	188	131	0.679	0.679	OBRG_HUMAN Leptin receptor gene-related protein OS=Homo sapiens OX=9606 GN=LEPROT PE=1 SV=1
6	P47111	3.23e-13	63.9	140	0.321	0.300	VPS55_YEAST Vacuolar protein sorting-associated protein 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS55 PE=1 SV=1
7	Q9AST6	2.25e-10	56.6	140	0.267	0.250	VSP55_ARATH Vacuolar protein sorting-associated protein 55 homolog OS=Arabidopsis thaliana OX=3702 GN=At1g32410 PE=2 SV=1
8	Q9UUH1	6.00e-10	55.5	128	0.275	0.281	VPS55_SCHPO Vacuolar protein sorting-associated protein 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps55 PE=3 SV=2
9	F4J6B8	0.001	38.5	113	0.214	0.248	F4J6B8_ARATH Vacuolar protein sorting 55 (VPS55) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g11530 PE=1 SV=1
10	O64474	4.8	29.3	1172	0.168	0.019	HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana OX=3702 GN=HMA4 PE=1 SV=2
11	P10090	7.1	28.9	687	0.107	0.020	WHITE_DROME Protein white OS=Drosophila melanogaster OX=7227 GN=w PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04133 Vps55	5.7e-36	134.4	Vacuolar protein sorting 55
2	PF14256 YwiC	5.4e+02	12.3	YwiC-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014447

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004705	0.796	Transmembrane protein 50B
2	61853.ENSNLEP00000024392	0.796	Transmembrane protein 50A
3	61853.ENSNLEP00000019606	0.639	Pleckstrin homology domain containing, family S member 1
4	61853.ENSNLEP00000004588	0.638	annotation not available
5	61853.ENSNLEP00000005190	0.638	WD repeat domain 74
6	61853.ENSNLEP00000000833	0.636	Plexin domain containing 1
7	61853.ENSNLEP00000023640	0.599	Ring finger and SPRY domain containing 1
8	61853.ENSNLEP00000013239	0.593	RAB13, member RAS oncogene family
9	61853.ENSNLEP00000018469	0.583	Leptin receptor
10	61853.ENSNLEP00000002574	0.549	Sarcoglycan, zeta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.505	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.983	biological regulation
GO:0048522	0.967	positive regulation of cellular process
GO:0060341	0.958	regulation of cellular localization
GO:0048523	0.952	negative regulation of cellular process
GO:0051223	0.950	regulation of protein transport
GO:0032386	0.944	regulation of intracellular transport
GO:0048583	0.941	regulation of response to stimulus
GO:1904892	0.933	regulation of receptor signaling pathway via STAT
GO:0033157	0.933	regulation of intracellular protein transport
GO:0051222	0.932	positive regulation of protein transport
GO:0090316	0.923	positive regulation of intracellular protein transport
GO:2000008	0.921	regulation of protein localization to cell surface
GO:1903747	0.921	regulation of establishment of protein localization to mitochondrion
GO:1903828	0.918	negative regulation of protein localization
GO:1904893	0.918	negative regulation of receptor signaling pathway via STAT
GO:1903533	0.903	regulation of protein targeting
GO:0009987	0.785	cellular process
GO:0046425	0.665	regulation of receptor signaling pathway via JAK-STAT
GO:0046426	0.364	negative regulation of receptor signaling pathway via JAK-STAT

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031982	0.971	vesicle
GO:0031410	0.939	cytoplasmic vesicle
GO:0005768	0.879	endosome
GO:0005794	0.871	Golgi apparatus
GO:0016020	0.790	membrane
GO:0031090	0.387	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]