StarFunc result for job id O95219

User Input

>input (450 residues)
MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEI
SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVY
YPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLF
LTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRV
RARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHY
ADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTT
KLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE
ALISYAVMQISMCKKGIQVWTNAKECFSKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95219	1.000	1.000	1.696E-70	450	1.000	1.000	O95219.pdb.gz	SNX4_HUMAN Sorting nexin-4 OS=Homo sapiens OX=9606 GN=SNX4 PE=1 SV=1
2	AFDB:A0A0R4IBS8	0.723	0.695	2.980E-20	469	0.242	0.232	A0A0R4IBS8.pdb.gz	A0A0R4IBS8_DANRE Sorting nexin 7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
3	AFDB:A0A0R4IIY5	0.629	0.649	9.843E-20	435	0.224	0.232	A0A0R4IIY5.pdb.gz	A0A0R4IIY5_DANRE Sorting nexin-7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
4	AFDB:Q5VWJ9	0.609	0.626	1.655E-19	437	0.216	0.222	Q5VWJ9.pdb.gz	SNX30_HUMAN Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1
5	AFDB:Q9CY18	0.631	0.726	2.146E-19	387	0.198	0.230	Q9CY18.pdb.gz	SNX7_MOUSE Sorting nexin-7 OS=Mus musculus OX=10090 GN=Snx7 PE=1 SV=1
6	AFDB:P47057	0.724	0.766	2.381E-19	423	0.193	0.206	P47057.pdb.gz	SNX4_YEAST Sorting nexin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNX4 PE=1 SV=1
7	AFDB:Q9FG38	0.639	0.708	2.302E-17	402	0.182	0.204	Q9FG38.pdb.gz	SNX1_ARATH Sorting nexin 1 OS=Arabidopsis thaliana OX=3702 GN=SNX1 PE=1 SV=1
8	AFDB:B9DFS6	0.658	0.530	2.834E-17	572	0.202	0.159	B9DFS6.pdb.gz	SNX2B_ARATH Sorting nexin 2B OS=Arabidopsis thaliana OX=3702 GN=SNX2B PE=1 SV=1
9	AFDB:Q9C0U7	0.637	0.510	5.286E-17	576	0.196	0.153	Q9C0U7.pdb.gz	VPS5_SCHPO Vacuolar protein sorting-associated protein vps5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps5 PE=1 SV=1
10	AFDB:O14243	0.676	0.750	6.507E-17	401	0.180	0.202	O14243.pdb.gz	SNX4_SCHPO Sorting nexin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx4 PE=1 SV=3
11	PDB:6q0xA	0.558	0.657	1.142E-9	373	0.151	0.182	6q0xA.pdb.gz
12	PDB:7d6dA	0.543	0.628	7.816E-6	380	0.158	0.187	7d6dA.pdb.gz
13	PDB:1ocuA	0.205	0.621	9.966E-5	134	0.073	0.246	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
14	PDB:2mxcA	0.232	0.550	2.674E-4	172	0.093	0.244	2mxcA.pdb.gz
15	PDB:4pzgA	0.211	0.572	5.254E-4	152	0.069	0.204	4pzgA.pdb.gz
16	PDB:6ikoA	0.265	0.365	3.783E-3	303	0.062	0.092	6ikoA.pdb.gz
17	PDB:3hajA	0.233	0.304	4.127E-2	286	0.049	0.077	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:2ygkA	0.085	0.104	5.263E-1	319	0.040	0.056	2ygkA.pdb.gz	Structural and Functional Insights Into DNA-End Processing by the Archaeal Hera Helicase-Nura Nuclease Complex.
19	PDB:7f1qR	0.096	0.114	5.543E-1	367	0.069	0.084	7f1qR.pdb.gz
20	PDB:3qf4B	0.110	0.086	7.187E-1	588	0.118	0.090	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95219	0.0	941	450	1.000	1.000	SNX4_HUMAN Sorting nexin-4 OS=Homo sapiens OX=9606 GN=SNX4 PE=1 SV=1
2	Q91YJ2	0.0	889	450	0.940	0.940	SNX4_MOUSE Sorting nexin-4 OS=Mus musculus OX=10090 GN=Snx4 PE=1 SV=1
3	A0A0R4IBS8	5.59e-28	117	469	0.231	0.222	A0A0R4IBS8_DANRE Sorting nexin 7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
4	Q6GMJ0	2.01e-23	103	413	0.173	0.189	Q6GMJ0_DANRE Zgc:92458 OS=Danio rerio OX=7955 GN=zgc:92458 PE=2 SV=1
5	A0A0R4IIY5	2.07e-23	104	435	0.176	0.182	A0A0R4IIY5_DANRE Sorting nexin-7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
6	Q5VWJ9	1.55e-22	101	437	0.164	0.169	SNX30_HUMAN Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1
7	Q9CY18	7.06e-20	93.2	387	0.198	0.230	SNX7_MOUSE Sorting nexin-7 OS=Mus musculus OX=10090 GN=Snx7 PE=1 SV=1
8	Q9UNH6	2.41e-19	91.7	387	0.209	0.243	SNX7_HUMAN Sorting nexin-7 OS=Homo sapiens OX=9606 GN=SNX7 PE=1 SV=1
9	P47057	5.99e-19	90.9	423	0.211	0.225	SNX4_YEAST Sorting nexin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNX4 PE=1 SV=1
10	O14243	1.71e-11	67.8	401	0.198	0.222	SNX4_SCHPO Sorting nexin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx4 PE=1 SV=3
11	Q9C0U7	2.23e-11	68.2	576	0.084	0.066	VPS5_SCHPO Vacuolar protein sorting-associated protein vps5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps5 PE=1 SV=1
12	O60107	3.45e-10	64.3	586	0.124	0.096	SNX41_SCHPO Sorting nexin-41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx41 PE=1 SV=1
13	Q9FG38	4.65e-10	63.5	402	0.193	0.216	SNX1_ARATH Sorting nexin 1 OS=Arabidopsis thaliana OX=3702 GN=SNX1 PE=1 SV=1
14	O60749	1.20e-09	62.8	519	0.216	0.187	SNX2_HUMAN Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2
15	Q9CWK8	1.28e-09	62.4	519	0.211	0.183	SNX2_MOUSE Sorting nexin-2 OS=Mus musculus OX=10090 GN=Snx2 PE=1 SV=2
16	P40959	3.48e-09	61.2	511	0.071	0.063	MVP1_YEAST Sorting nexin MVP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MVP1 PE=1 SV=2
17	Q9P779	4.74e-09	60.5	390	0.084	0.097	YNYB_SCHPO Sorting nexin C1711.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1711.11 PE=3 SV=1
18	Q38D86	7.30e-09	59.7	419	0.222	0.239	Q38D86_TRYB2 Phosphoinositide-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4240 PE=4 SV=1
19	Q9Y5X2	9.41e-09	59.7	465	0.144	0.140	SNX8_HUMAN Sorting nexin-8 OS=Homo sapiens OX=9606 GN=SNX8 PE=1 SV=1
20	D6RC15	1.16e-08	58.2	265	0.107	0.181	D6RC15_HUMAN Sorting nexin-2 (Fragment) OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=8

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10819 DUF2564	2.5e+02	13.5	Protein of unknown function (DUF2564)
2	PF04316 FlgM	2.2e+02	13.6	Anti-sigma-28 factor, FlgM
3	PF07544 Med9	9.8e+02	11.3	RNA polymerase II transcription mediator complex subunit 9
4	PF13675 PilJ	3e+02	12.9	Type IV pili methyl-accepting chemotaxis transducer N-term
5	PF00787 PX	8.8e-17	72.9	PX domain
6	PF09325 Vps5	0.46	21.6	Vps5 C terminal like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251775

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427772	0.978	Protein KIBRA
2	9606.ENSP00000360183	0.938	Syntaxin-16
3	9606.ENSP00000262640	0.932	Vesicle-associated membrane protein 7
4	9606.ENSP00000273130	0.932	Cytoplasmic dynein 1 light intermediate chain 1
5	9606.ENSP00000263864	0.927	Vesicle-associated membrane protein 8
6	9606.ENSP00000314214	0.925	Vesicle-associated membrane protein 2
7	9606.ENSP00000363054	0.924	Syntaxin-12
8	9606.ENSP00000054666	0.923	Vesicle-associated membrane protein 3
9	9606.ENSP00000259400	0.921	Syntaxin-17
10	9606.ENSP00000317714	0.920	Syntaxin-4
11	9606.ENSP00000222812	0.918	Syntaxin-1A
12	9606.ENSP00000355217	0.918	Sorting nexin-6
13	9606.ENSP00000258301	0.915	Syntaxin-6
14	9606.ENSP00000215730	0.910	Synaptosomal-associated protein 29
15	9606.ENSP00000249647	0.910	Synaptosomal-associated protein 23
16	9606.ENSP00000254976	0.910	Synaptosomal-associated protein 25
17	9606.ENSP00000367841	0.903	Dynein light chain Tctex-type 3
18	9606.ENSP00000261889	0.902	Sorting nexin-1
19	9606.ENSP00000356448	0.902	Nucleoprotein TPR
20	9606.ENSP00000304429	0.892	Sorting nexin-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032266	0.998	phosphatidylinositol-3-phosphate binding
GO:0005102	0.992	signaling receptor binding
GO:0044877	0.984	protein-containing complex binding
GO:0005158	0.974	insulin receptor binding
GO:0070851	0.973	growth factor receptor binding
GO:0005154	0.927	epidermal growth factor receptor binding
GO:1990460	0.376	leptin receptor binding
GO:1990459	0.372	transferrin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051641	0.989	cellular localization
GO:0006810	0.989	transport
GO:0050794	0.987	regulation of cellular process
GO:0032879	0.979	regulation of localization
GO:0051049	0.971	regulation of transport
GO:0016192	0.956	vesicle-mediated transport
GO:0002886	0.949	regulation of myeloid leukocyte mediated immunity
GO:0046907	0.949	intracellular transport
GO:0060627	0.947	regulation of vesicle-mediated transport
GO:0045184	0.919	establishment of protein localization
GO:0016197	0.916	endosomal transport
GO:0009894	0.915	regulation of catabolic process
GO:0015031	0.907	protein transport
GO:0017157	0.900	regulation of exocytosis
GO:0048583	0.891	regulation of response to stimulus
GO:0048518	0.878	positive regulation of biological process
GO:0043300	0.875	regulation of leukocyte degranulation
GO:0002699	0.869	positive regulation of immune effector process
GO:0002694	0.861	regulation of leukocyte activation
GO:0033003	0.852	regulation of mast cell activation
GO:0033006	0.841	regulation of mast cell activation involved in immune response
GO:0048522	0.835	positive regulation of cellular process
GO:1903532	0.832	positive regulation of secretion by cell
GO:0031323	0.827	regulation of cellular metabolic process
GO:0045921	0.806	positive regulation of exocytosis
GO:0043304	0.806	regulation of mast cell degranulation
GO:1902115	0.799	regulation of organelle assembly
GO:0016241	0.780	regulation of macroautophagy
GO:2000785	0.742	regulation of autophagosome assembly
GO:1902117	0.738	positive regulation of organelle assembly
GO:0016239	0.708	positive regulation of macroautophagy
GO:1903307	0.676	positive regulation of regulated secretory pathway
GO:0032101	0.672	regulation of response to external stimulus
GO:0043302	0.610	positive regulation of leukocyte degranulation
GO:0023051	0.596	regulation of signaling
GO:0065008	0.491	regulation of biological quality
GO:0010646	0.489	regulation of cell communication
GO:0048584	0.443	positive regulation of response to stimulus
GO:0051668	0.410	localization within membrane
GO:0050727	0.410	regulation of inflammatory response
GO:0098876	0.396	vesicle-mediated transport to the plasma membrane
GO:0032103	0.390	positive regulation of response to external stimulus
GO:0031349	0.387	positive regulation of defense response
GO:0032456	0.380	endocytic recycling
GO:0071840	0.355	cellular component organization or biogenesis
GO:0016043	0.351	cellular component organization
GO:0050729	0.343	positive regulation of inflammatory response
GO:0023056	0.336	positive regulation of signaling
GO:0010647	0.336	positive regulation of cell communication
GO:0044090	0.320	positive regulation of vacuole organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0016020	0.992	membrane
GO:0032991	0.963	protein-containing complex
GO:0031090	0.934	organelle membrane
GO:0098588	0.917	bounding membrane of organelle
GO:0030659	0.887	cytoplasmic vesicle membrane
GO:0005769	0.820	early endosome
GO:0010008	0.808	endosome membrane
GO:0043232	0.742	intracellular non-membrane-bounded organelle
GO:0031901	0.666	early endosome membrane
GO:0098796	0.648	membrane protein complex
GO:0005856	0.647	cytoskeleton
GO:0015630	0.591	microtubule cytoskeleton
GO:0030054	0.586	cell junction
GO:1902494	0.529	catalytic complex
GO:0045202	0.498	synapse
GO:0071944	0.486	cell periphery
GO:0005886	0.476	plasma membrane
GO:0005875	0.467	microtubule associated complex
GO:0005868	0.457	cytoplasmic dynein complex
GO:0005829	0.342	cytosol
GO:0098793	0.305	presynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]