StarFunc result for job id O95229

User Input

>input (277 residues)
MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVA
DFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQ
MEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTG
TQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKP
QQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95229	1.000	1.000	6.691E-38	277	1.000	1.000	O95229.pdb.gz	ZWINT_HUMAN ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT PE=1 SV=2
2	AFDB:Q8VIL3	0.543	0.561	2.182E-14	266	0.487	0.508	Q8VIL3.pdb.gz	ZWINT_RAT ZW10 interactor OS=Rattus norvegicus OX=10116 GN=Zwint PE=1 SV=1
3	AFDB:P21263	0.406	0.073	4.544E-1	1893	0.209	0.031	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
4	AFDB:Q6P5H2	0.444	0.075	4.902E-1	1864	0.209	0.031	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
5	AFDB:F8W785	0.418	0.179	2.229	668	0.162	0.067	F8W785.pdb.gz	F8W785_HUMAN Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1
6	AFDB:O00461	0.430	0.176	2.229	696	0.177	0.070	O00461.pdb.gz	GOLI4_HUMAN Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1
7	AFDB:B7Z0R7	0.278	0.163	2.404	612	0.152	0.069	B7Z0R7.pdb.gz	B7Z0R7_DROME Autophagy-related 16, isoform F OS=Drosophila melanogaster OX=7227 GN=Atg16 PE=1 SV=2
8	AFDB:E9Q5G3	0.214	0.076	2.593	953	0.170	0.049	E9Q5G3.pdb.gz	KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus OX=10090 GN=Kif23 PE=1 SV=1
9	AFDB:Q8IYM0	0.203	0.072	2.593	893	0.209	0.065	Q8IYM0.pdb.gz	F186B_HUMAN Protein FAM186B OS=Homo sapiens OX=9606 GN=FAM186B PE=2 SV=2
10	AFDB:Q3V0F0	0.239	0.061	3.017	1606	0.220	0.038	Q3V0F0.pdb.gz	RIMB3_MOUSE RIMS-binding protein 3 OS=Mus musculus OX=10090 GN=Rimbp3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95229	0.0	550	277	1.000	1.000	ZWINT_HUMAN ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT PE=1 SV=2
2	A6NH27	3.83e-110	317	157	0.567	1.000	A6NH27_HUMAN ZW10 interacting kinetochore protein OS=Homo sapiens OX=9606 GN=ZWINT PE=1 SV=1
3	Q9CQU5	8.88e-81	246	252	0.491	0.540	ZWINT_MOUSE ZW10 interactor OS=Mus musculus OX=10090 GN=Zwint PE=1 SV=1
4	Q8VIL3	6.65e-79	241	266	0.495	0.515	ZWINT_RAT ZW10 interactor OS=Rattus norvegicus OX=10116 GN=Zwint PE=1 SV=1
5	Q8I3S3	0.28	35.4	1894	0.097	0.014	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
6	P33332	0.69	33.9	1336	0.072	0.015	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
7	O13892	1.5	32.7	1076	0.119	0.031	YE38_SCHPO Uncharacterized protein C20G4.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC20G4.08 PE=1 SV=2
8	Q8IDX6	1.7	32.7	3130	0.094	0.008	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
9	P18648	2.3	32.0	265	0.119	0.125	APOA1_PIG Apolipoprotein A-I OS=Sus scrofa OX=9823 GN=APOA1 PE=1 SV=4
10	Q80V85	5.3	30.8	475	0.159	0.093	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
11	Q64291	5.6	30.8	487	0.116	0.066	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
12	Q53GS7	7.2	30.8	698	0.119	0.047	GLE1_HUMAN mRNA export factor GLE1 OS=Homo sapiens OX=9606 GN=GLE1 PE=1 SV=2
13	Q9GQR6	8.4	30.0	234	0.126	0.150	Q9GQR6_DROME Stathmin-1 OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1
14	Q9GQR4	8.5	29.6	174	0.094	0.149	Q9GQR4_DROME Stathmin (Fragment) OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05478 Prominin	3.3e+02	10.7	Prominin
2	PF15556 Zwint	6.3e-135	460.0	ZW10 interactor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363055

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335463	0.999	Kinetochore scaffold 1
2	9606.ENSP00000287598	0.994	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
3	9606.ENSP00000261597	0.993	Kinetochore protein NDC80 homolog
4	9606.ENSP00000200135	0.991	Centromere/kinetochore protein zw10 homolog
5	9606.ENSP00000484532	0.990	Protein MIS12 homolog
6	9606.ENSP00000355944	0.989	Kinetochore-associated protein NSL1 homolog
7	9606.ENSP00000389810	0.984	Kinetochore-associated protein DSN1 homolog
8	9606.ENSP00000302530	0.983	Mitotic checkpoint serine/threonine-protein kinase BUB1
9	9606.ENSP00000271452	0.981	Kinetochore protein Nuf2
10	9606.ENSP00000357256	0.977	Polyamine-modulated factor 1
11	9606.ENSP00000465075	0.966	Kinetochore protein Spc24
12	9606.ENSP00000282074	0.952	Kinetochore protein Spc25
13	9606.ENSP00000311429	0.928	Protein zwilch homolog
14	9606.ENSP00000265148	0.923	Centromere-associated protein E
15	9606.ENSP00000378699	0.911	Cyclin-dependent kinase 1
16	9606.ENSP00000296509	0.910	Mitotic spindle assembly checkpoint protein MAD2A
17	9606.ENSP00000273853	0.908	Centromere protein C
18	9606.ENSP00000336868	0.908	Histone H3-like centromeric protein A
19	9606.ENSP00000281453	0.903	Centromere protein U
20	9606.ENSP00000453403	0.899	Nucleolar and spindle-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0010564	0.991	regulation of cell cycle process
GO:0033043	0.988	regulation of organelle organization
GO:1903047	0.987	mitotic cell cycle process
GO:0033044	0.977	regulation of chromosome organization
GO:1901990	0.977	regulation of mitotic cell cycle phase transition
GO:0007093	0.976	mitotic cell cycle checkpoint signaling
GO:0007059	0.973	chromosome segregation
GO:0006996	0.967	organelle organization
GO:0051983	0.966	regulation of chromosome segregation
GO:0010639	0.966	negative regulation of organelle organization
GO:0007088	0.966	regulation of mitotic nuclear division
GO:0000070	0.963	mitotic sister chromatid segregation
GO:1901991	0.958	negative regulation of mitotic cell cycle phase transition
GO:0033047	0.939	regulation of mitotic sister chromatid segregation
GO:0030071	0.939	regulation of mitotic metaphase/anaphase transition
GO:0051179	0.929	localization
GO:1905818	0.926	regulation of chromosome separation
GO:0045841	0.916	negative regulation of mitotic metaphase/anaphase transition
GO:0007094	0.914	mitotic spindle assembly checkpoint signaling
GO:0051641	0.881	cellular localization
GO:0051234	0.410	establishment of localization
GO:0051649	0.372	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005694	0.997	chromosome
GO:0099080	0.995	supramolecular complex
GO:0016604	0.993	nuclear body
GO:0000779	0.988	condensed chromosome, centromeric region
GO:0000776	0.983	kinetochore
GO:0032991	0.540	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]