StarFunc result for job id O95236

User Input

>input (402 residues)
MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLR
TAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEA
DALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEV
HRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIV
EHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQ
ARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYES
KHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95236	1.000	1.000	3.063E-52	402	1.000	1.000	O95236.pdb.gz	APOL3_HUMAN Apolipoprotein L3 OS=Homo sapiens OX=9606 GN=APOL3 PE=1 SV=3
2	AFDB:Q9BPW4	0.331	0.366	3.237E-19	351	0.483	0.553	Q9BPW4.pdb.gz	APOL4_HUMAN Apolipoprotein L4 OS=Homo sapiens OX=9606 GN=APOL4 PE=2 SV=3
3	AFDB:Q9BQE5	0.278	0.327	3.239E-16	337	0.430	0.513	Q9BQE5.pdb.gz	APOL2_HUMAN Apolipoprotein L2 OS=Homo sapiens OX=9606 GN=APOL2 PE=1 SV=2
4	AFDB:O14791	0.300	0.302	5.066E-16	398	0.398	0.402	O14791.pdb.gz	APOL1_HUMAN Apolipoprotein L1 OS=Homo sapiens OX=9606 GN=APOL1 PE=1 SV=5
5	AFDB:F1SPU1	0.273	0.314	2.838E-14	339	0.400	0.475	F1SPU1.pdb.gz	F1SPU1_PIG Apolipoprotein L3 isoform X1 OS=Sus scrofa OX=9823 GN=LOC106510284 PE=3 SV=3
6	AFDB:P50090	0.104	0.059	6.091E-3	882	0.144	0.066	P50090.pdb.gz	KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KEL2 PE=1 SV=1
7	AFDB:Q7L8J4	0.125	0.127	6.619E-2	393	0.162	0.165	Q7L8J4.pdb.gz	3BP5L_HUMAN SH3 domain-binding protein 5-like OS=Homo sapiens OX=9606 GN=SH3BP5L PE=1 SV=1
8	AFDB:M9PGK7	0.157	0.041	1.788E-1	2272	0.132	0.023	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
9	AFDB:Q400N1	0.140	0.060	2.410E-1	1109	0.182	0.066	Q400N1.pdb.gz	Q400N1_DROME FI22203p1 OS=Drosophila melanogaster OX=7227 GN=Plp PE=1 SV=1
10	AFDB:Q23064	0.119	0.063	3.586E-1	1041	0.129	0.050	Q23064.pdb.gz	UNC83_CAEEL Nuclear migration protein unc-83 OS=Caenorhabditis elegans OX=6239 GN=unc-83 PE=1 SV=2
11	PDB:7ungC4	0.135	0.195	7.730E-1	219	0.082	0.151	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:4o9yA	0.113	0.028	1.335	2490	0.092	0.015	4o9yA.pdb.gz
13	PDB:7lp9A	0.141	0.099	1.987	634	0.080	0.050	7lp9A.pdb.gz	Heat-dependent opening of TRPV1 in the presence of capsaicin.
14	PDB:6whgA	0.106	0.087	2.089	523	0.070	0.054	6whgA.pdb.gz	Structure of the ancient TRPY1 channel from Saccharomyces cerevisiae reveals mechanisms of modulation by lipids and calcium.
15	PDB:2b5uA	0.119	0.105	2.548	470	0.047	0.040	2b5uA.pdb.gz
16	PDB:3hajA	0.180	0.234	2.548	286	0.075	0.105	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:3szrA	0.116	0.092	2.678	559	0.102	0.073	3szrA.pdb.gz
18	PDB:7ktsD	0.077	0.127	3.792	219	0.062	0.114	7ktsD.pdb.gz
19	PDB:5lkiA	0.106	0.043	4.402	1427	0.092	0.026	5lkiA.pdb.gz
20	PDB:7rraA	0.096	0.075	4.862	602	0.100	0.066	7rraA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95236	0.0	823	402	1.000	1.000	APOL3_HUMAN Apolipoprotein L3 OS=Homo sapiens OX=9606 GN=APOL3 PE=1 SV=3
2	Q9BPW4	1.98e-125	368	351	0.485	0.556	APOL4_HUMAN Apolipoprotein L4 OS=Homo sapiens OX=9606 GN=APOL4 PE=2 SV=3
3	F1SPU1	9.21e-97	294	339	0.405	0.481	F1SPU1_PIG Apolipoprotein L3 isoform X1 OS=Sus scrofa OX=9823 GN=LOC106510284 PE=3 SV=3
4	O14791	1.34e-88	275	398	0.388	0.392	APOL1_HUMAN Apolipoprotein L1 OS=Homo sapiens OX=9606 GN=APOL1 PE=1 SV=5
5	Q9BQE5	6.36e-88	271	337	0.428	0.510	APOL2_HUMAN Apolipoprotein L2 OS=Homo sapiens OX=9606 GN=APOL2 PE=1 SV=2
6	B3KTP4	3.56e-46	164	343	0.276	0.324	B3KTP4_HUMAN Apolipoprotein L, 6 OS=Homo sapiens OX=9606 GN=ApoL6 PE=1 SV=1
7	Q9BWW8	3.56e-46	164	343	0.276	0.324	APOL6_HUMAN Apolipoprotein L6 OS=Homo sapiens OX=9606 GN=APOL6 PE=1 SV=1
8	Q7T131	5.59e-19	89.4	326	0.194	0.239	Q7T131_DANRE Apolipoprotein L, 1 OS=Danio rerio OX=7955 GN=wu:fc30h04 PE=2 SV=1
9	Q9VKC9	0.057	38.1	496	0.122	0.099	Q9VKC9_DROME Dietary and metabolic glutamate transporter OS=Drosophila melanogaster OX=7227 GN=dmGlut PE=2 SV=2
10	C6KTF5	0.12	36.6	359	0.102	0.114	C6KTF5_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0632300 PE=4 SV=1
11	P26616	0.86	34.3	565	0.102	0.073	MAO1_ECOLI NAD-dependent malic enzyme OS=Escherichia coli (strain K12) OX=83333 GN=maeA PE=1 SV=4
12	Q6FVW6	1.7	33.5	692	0.090	0.052	Q6FVW6_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=KAR3 PE=1 SV=1
13	Q94AY3	2.3	32.7	420	0.062	0.060	DRIP2_ARATH E3 ubiquitin protein ligase DRIP2 OS=Arabidopsis thaliana OX=3702 GN=DRIP2 PE=1 SV=1
14	Q59SD1	3.1	32.0	248	0.104	0.169	Q59SD1_CANAL Vacuolar protein sorting-associated protein 28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS28 PE=3 SV=1
15	Q6DNE7	3.3	32.7	3195	0.032	0.004	Q6DNE7_9CYAN 3-hydroxyacyl-CoA dehydrogenase OS=Lyngbya majuscula OX=158786 GN=curF PE=1 SV=1
16	Q6B959	3.8	32.0	246	0.072	0.118	APLD1_RAT Apolipoprotein L domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Apold1 PE=1 SV=1
17	D6RCD7	6.2	31.6	665	0.062	0.038	D6RCD7_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2
18	P9WPT5	6.2	31.6	718	0.040	0.022	CTPC_MYCTU Manganese-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ctpC PE=1 SV=1
19	C0H4Q7	7.5	31.2	359	0.097	0.109	C0H4Q7_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0732700 PE=4 SV=1
20	A5FB63	8.3	31.2	1578	0.055	0.014	CHIA_FLAJ1 Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05461 ApoL	4.1e-125	428.7	Apolipoprotein L
2	PF03564 DUF1759	5.5e+02	11.9	Protein of unknown function (DUF1759)
3	PF11348 DUF3150	58	14.4	Protein of unknown function (DUF3150)
4	PF18908 DUF5663	3.5e+02	13.1	Protein of unknown function (DUF5663)
5	PF19191 HEF_HK	52	15.8	HEF_HK domain
6	PF18160 SLATT_5	9.5e+02	10.5	SMODS and SLOG-associating 2TM effector domain family 5
7	PF02970 TBCA	3.9	19.2	Tubulin binding cofactor A
8	PF00872 Transposase_mut	72	13.7	Transposase, Mutator family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344577

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359504	0.523	Guanylate-binding protein 1
2	9606.ENSP00000255688	0.507	Retinoic acid receptor responder protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005319	1.000	lipid transporter activity
GO:1901363	0.372	heterocyclic compound binding
GO:0097159	0.372	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0043122	0.988	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0006952	0.979	defense response
GO:1902533	0.965	positive regulation of intracellular signal transduction
GO:0043123	0.959	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006954	0.903	inflammatory response
GO:0009987	0.826	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005622	0.962	intracellular anatomical structure
GO:0043229	0.906	intracellular organelle
GO:0043231	0.884	intracellular membrane-bounded organelle
GO:0005737	0.803	cytoplasm
GO:0005829	0.561	cytosol
GO:0005576	0.327	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]