StarFunc result for job id O95238

User Input

>input (335 residues)
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYL
SYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLE
QVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAG
KELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEV
DSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAM
NYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95238	1.000	1.000	2.799E-54	335	1.000	1.000	O95238.pdb.gz	SPDEF_HUMAN SAM pointed domain-containing Ets transcription factor OS=Homo sapiens OX=9606 GN=SPDEF PE=1 SV=1
2	AFDB:Q9WTP3	0.341	0.350	1.675E-44	325	0.854	0.880	Q9WTP3.pdb.gz	SPDEF_MOUSE SAM pointed domain-containing Ets transcription factor OS=Mus musculus OX=10090 GN=Spdef PE=2 SV=1
3	AFDB:A8WFJ9	0.297	0.230	2.713E-16	437	0.310	0.238	A8WFJ9.pdb.gz	ETS4_CAEEL Transcription factor ets-4 OS=Caenorhabditis elegans OX=6239 GN=ets-4 PE=1 SV=1
4	AFDB:A8IE48	0.247	0.184	4.240E-13	454	0.236	0.174	A8IE48.pdb.gz	A8IE48_HUMAN GA binding protein transcription factor alpha subunit 60kDa OS=Homo sapiens OX=9606 GN=GABPA PE=2 SV=1
5	AFDB:Q9UKW6	0.245	0.308	8.317E-13	265	0.227	0.287	Q9UKW6.pdb.gz	ELF5_HUMAN ETS-related transcription factor Elf-5 OS=Homo sapiens OX=9606 GN=ELF5 PE=1 SV=2
6	AFDB:Q9NZC4	0.248	0.272	2.281E-10	300	0.209	0.233	Q9NZC4.pdb.gz	EHF_HUMAN ETS homologous factor OS=Homo sapiens OX=9606 GN=EHF PE=2 SV=1
7	AFDB:P15036	0.249	0.182	1.538E-9	469	0.275	0.196	P15036.pdb.gz	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
8	AFDB:P97360	0.238	0.170	1.538E-9	485	0.269	0.186	P97360.pdb.gz	ETV6_MOUSE Transcription factor ETV6 OS=Mus musculus OX=10090 GN=Etv6 PE=1 SV=1
9	AFDB:D4AAH4	0.252	0.183	1.926E-9	470	0.272	0.194	D4AAH4.pdb.gz	D4AAH4_RAT ETS proto-oncogene 2, transcription factor OS=Rattus norvegicus OX=10116 GN=Ets2 PE=3 SV=2
10	AFDB:P10157	0.254	0.181	5.919E-9	479	0.284	0.198	P10157.pdb.gz	ETS2_CHICK Protein C-ets-2 OS=Gallus gallus OX=9031 GN=ETS2 PE=2 SV=1
11	PDB:2qb0B	0.207	0.277	6.641E-4	241	0.113	0.158	2qb0B.pdb.gz	Polymer-driven crystallization.
12	PDB:4byyA	0.161	0.224	2.411E-1	226	0.054	0.080	4byyA.pdb.gz
13	PDB:6w6wC	0.130	0.134	5.003E-1	323	0.045	0.046	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
14	PDB:4v8mAU	0.107	0.317	7.839E-1	85	0.030	0.118	4v8mAU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
15	PDB:3m8eA	0.104	0.296	9.277E-1	101	0.021	0.069	3m8eA.pdb.gz
16	PDB:5i2dG	0.162	0.254	9.277E-1	195	0.027	0.046	5i2dG.pdb.gz	Structural basis of transcription activation.
17	PDB:5aj0BZ	0.116	0.342	9.813E-1	86	0.039	0.151	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:3bs5A	0.180	0.581	1.161	86	0.042	0.163	3bs5A.pdb.gz
19	PDB:1jhfA	0.144	0.226	1.228	197	0.033	0.056	1jhfA.pdb.gz
20	PDB:6v9iC	0.146	0.073	1.228	730	0.030	0.014	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95238	0.0	688	335	1.000	1.000	SPDEF_HUMAN SAM pointed domain-containing Ets transcription factor OS=Homo sapiens OX=9606 GN=SPDEF PE=1 SV=1
2	Q9WTP3	0.0	586	325	0.857	0.883	SPDEF_MOUSE SAM pointed domain-containing Ets transcription factor OS=Mus musculus OX=10090 GN=Spdef PE=2 SV=1
3	A8WFJ9	2.78e-31	124	437	0.170	0.130	ETS4_CAEEL Transcription factor ets-4 OS=Caenorhabditis elegans OX=6239 GN=ets-4 PE=1 SV=1
4	Q9UKW6	1.96e-29	115	265	0.206	0.260	ELF5_HUMAN ETS-related transcription factor Elf-5 OS=Homo sapiens OX=9606 GN=ELF5 PE=1 SV=2
5	Q8VDK3	3.98e-29	114	253	0.206	0.273	ELF5_MOUSE ETS-related transcription factor Elf-5 OS=Mus musculus OX=10090 GN=Elf5 PE=2 SV=2
6	H2KYY1	1.34e-24	105	420	0.134	0.107	H2KYY1_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=1
7	Q400M2	1.74e-24	105	419	0.134	0.107	Q400M2_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=2
8	P20105	5.91e-24	105	829	0.137	0.055	E74EA_DROME Ecdysone-induced protein 74EF isoform A OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
9	A8IE48	6.39e-24	103	454	0.254	0.187	A8IE48_HUMAN GA binding protein transcription factor alpha subunit 60kDa OS=Homo sapiens OX=9606 GN=GABPA PE=2 SV=1
10	Q06546	6.39e-24	103	454	0.254	0.187	GABPA_HUMAN GA-binding protein alpha chain OS=Homo sapiens OX=9606 GN=GABPA PE=1 SV=1
11	P11536	1.04e-23	104	883	0.140	0.053	E74EB_DROME Ecdysone-induced protein 74EF isoform B OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
12	Q00422	9.17e-23	100	454	0.206	0.152	GABPA_MOUSE GA-binding protein alpha chain OS=Mus musculus OX=10090 GN=Gabpa PE=1 SV=2
13	Q9JHC9	1.92e-22	100	593	0.125	0.071	ELF2_MOUSE ETS-related transcription factor Elf-2 OS=Mus musculus OX=10090 GN=Elf2 PE=1 SV=1
14	Q15723	1.99e-22	100	593	0.125	0.071	ELF2_HUMAN ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2 PE=1 SV=2
15	B7Z720	2.59e-22	99.8	521	0.125	0.081	B7Z720_HUMAN E74-like factor 2 (Ets domain transcription factor), isoform CRA_b OS=Homo sapiens OX=9606 GN=ELF2 PE=2 SV=1
16	Q04688	2.76e-22	99.4	464	0.221	0.159	ELG_DROME DNA-binding protein Ets97D OS=Drosophila melanogaster OX=7227 GN=Ets97D PE=1 SV=2
17	A0A2R8QGN6	3.70e-22	99.0	460	0.239	0.174	A0A2R8QGN6_DANRE Fli-1 proto-oncogene, ETS transcription factor a OS=Danio rerio OX=7955 GN=cb855 PE=1 SV=1
18	Q9PU61	4.54e-22	98.6	451	0.239	0.177	Q9PU61_DANRE Fli-1 protein OS=Danio rerio OX=7955 GN=fli1a PE=1 SV=1
19	Q9EQY3	7.89e-22	98.6	615	0.128	0.070	Q9EQY3_RAT Ets-family transcription factor ELF1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=2 SV=1
20	G3V9V2	8.12e-22	98.6	615	0.128	0.070	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	1.3e-30	116.8	Ets-domain
2	PF18016 SAM_3	1.9e+02	13.4	SAM domain (Sterile alpha motif)
3	PF02198 SAM_PNT	2e-22	90.3	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370253	0.960	Homeobox protein Nkx-3.1
2	9606.ENSP00000326110	0.832	UNC119-binding protein C5orf30
3	9606.ENSP00000363822	0.787	Androgen receptor
4	9606.ENSP00000346879	0.754	Homeobox protein Nkx-2.1
5	9606.ENSP00000485659	0.726	Mucin-5AC
6	9606.ENSP00000391490	0.724	Anterior gradient protein 2 homolog
7	9606.ENSP00000379377	0.721	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
8	9606.ENSP00000250448	0.695	Hepatocyte nuclear factor 3-alpha
9	9606.ENSP00000484060	0.688	Protein kinase C and casein kinase substrate in neurons protein 1
10	9606.ENSP00000337040	0.683	Protein unc-119 homolog A
11	9606.ENSP00000436812	0.634	Mucin-5B
12	9606.ENSP00000302216	0.605	Protein atonal homolog 1
13	9606.ENSP00000304004	0.601	Hepatocyte nuclear factor 3-gamma
14	9606.ENSP00000430690	0.590	Trefoil factor 3
15	9606.ENSP00000369045	0.588	Serine peptidase inhibitor, Kazal type 4
16	9606.ENSP00000376465	0.555	Polypeptide N-acetylgalactosaminyltransferase 3
17	9606.ENSP00000359357	0.551	Zinc finger protein Gfi-1
18	9606.ENSP00000383333	0.551	MORC family CW-type zinc finger protein 3
19	9606.ENSP00000444171	0.539	Polypeptide N-acetylgalactosaminyltransferase 6
20	9606.ENSP00000347821	0.535	MORC family CW-type zinc finger 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.956	transcription regulator activity
GO:0003700	0.951	DNA-binding transcription factor activity
GO:0000976	0.908	transcription cis-regulatory region binding
GO:0000981	0.868	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.828	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.558	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.354	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0048518	0.978	positive regulation of biological process
GO:0048522	0.969	positive regulation of cellular process
GO:0048519	0.944	negative regulation of biological process
GO:0006357	0.939	regulation of transcription by RNA polymerase II
GO:0009987	0.914	cellular process
GO:0048523	0.907	negative regulation of cellular process
GO:0000122	0.849	negative regulation of transcription by RNA polymerase II
GO:0010941	0.685	regulation of cell death
GO:0009893	0.609	positive regulation of metabolic process
GO:0010604	0.596	positive regulation of macromolecule metabolic process
GO:0032501	0.536	multicellular organismal process
GO:0032502	0.493	developmental process
GO:0048856	0.481	anatomical structure development
GO:0051173	0.441	positive regulation of nitrogen compound metabolic process
GO:0031325	0.441	positive regulation of cellular metabolic process
GO:0045893	0.419	positive regulation of DNA-templated transcription
GO:0042981	0.414	regulation of apoptotic process
GO:0008152	0.407	metabolic process
GO:0045944	0.407	positive regulation of transcription by RNA polymerase II
GO:0050896	0.385	response to stimulus
GO:0071704	0.385	organic substance metabolic process
GO:0044238	0.380	primary metabolic process
GO:0006807	0.326	nitrogen compound metabolic process
GO:0007275	0.324	multicellular organism development
GO:0044237	0.315	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.970	intracellular organelle lumen
GO:0005654	0.958	nucleoplasm
GO:0005737	0.936	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]