StarFunc result for job id O95239

User Input

>input (1232 residues)
MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTE
QEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQ
LLFKEIDKKSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKT
VLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISLEQRKKSDKNSSFRSKLHLVD
LAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGGFVPYRDSKLTRLLQDS
LGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVNIDPQTAELNHLKQQVQQ
LQVLLLQAHGGTLPGSITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERI
ILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDET
VACMAAAIDTAVEQEAQVETSPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALA
RKMTQNDSQLQPIQYQYQDNIKELELEVINLQKEKEELVLELQTAKKDANQAKLSERRRK
RLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIRMMKNQRVQLMRQMKEDAEK
FRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSNVLRRKTEEAAAANKRLKDALQK
QREVADKRKETQSRGMEGTAARVKNWLGNEIEVMVSTEEAKRHLNDLLEDRKILAQDVAQ
LKEKKESGENPPPKLRRRTFSLTEVRGQVSESEDSITKQIESLETEMEFRSAQIADLQQK
LLDAESEDRPKQRWENIATILEAKCALKYLIGELVSSKIQVSKLESSLKQSKTSCADMQK
MLFEERNHFAEIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEESVSEKEQQLL
STLKCQDEELEKMREVCEQNQQLLRENEIIKQKLTLLQVASRQKHLPKDTLLSPDSSFEY
VPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKLVKVSR
KNIQGCSCKGWCGNKQCGCRKQKSDCGVDCCCDPTKCRNRQQGKDSLGTVERTQDSEGSF
KLEDPTEVTPGLSFFNPVCATPNSKILKEMCDVEQVLSKKTPPAPSPFDLPELKHVATEY
QENKAPGKKKKRALASNTSFFSGCSPIEEEAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33174	0.725	0.726	0.000	1231	0.872	0.872	P33174.pdb.gz	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
2	AFDB:Q2VIQ3	0.677	0.676	0.000	1234	0.938	0.937	Q2VIQ3.pdb.gz	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
3	AFDB:Q9XZ29	0.578	0.587	2.289E-70	1212	0.336	0.342	Q9XZ29.pdb.gz	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
4	AFDB:O45935	0.276	0.312	3.455E-54	1083	0.261	0.296	O45935.pdb.gz	KLP19_CAEEL Kinesin-like protein klp-19 OS=Caenorhabditis elegans OX=6239 GN=klp-19 PE=2 SV=1
5	AFDB:Q6S003	0.286	0.189	1.618E-45	1873	0.283	0.186	Q6S003.pdb.gz	KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum OX=44689 GN=kif8 PE=2 SV=1
6	AFDB:Q6RZZ9	0.274	0.267	1.158E-39	1265	0.206	0.201	Q6RZZ9.pdb.gz	KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum OX=44689 GN=kif13 PE=1 SV=1
7	AFDB:Q382E5	0.272	0.300	3.638E-38	1115	0.208	0.230	Q382E5.pdb.gz	Q382E5_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5490 PE=3 SV=1
8	AFDB:P28742	0.269	0.298	1.018E-37	1111	0.209	0.232	P28742.pdb.gz	KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIP1 PE=1 SV=1
9	AFDB:Q9P2E2	0.281	0.335	1.203E-36	1029	0.152	0.182	Q9P2E2.pdb.gz	KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens OX=9606 GN=KIF17 PE=2 SV=3
10	AFDB:Q99PT9	0.265	0.326	3.038E-36	997	0.194	0.240	Q99PT9.pdb.gz	KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus OX=10090 GN=Kif19 PE=1 SV=2
11	PDB:7wrgA	0.257	0.386	1.812E-28	812	0.131	0.200	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.249	0.387	4.633E-27	783	0.125	0.197	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.221	0.400	1.170E-22	670	0.092	0.169	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:5w3sA	0.039	0.076	4.754E-1	485	0.019	0.047	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
15	PDB:7d6dA	0.064	0.174	4.754E-1	380	0.046	0.150	7d6dA.pdb.gz
16	PDB:2b5uA	0.097	0.230	6.149E-1	470	0.011	0.028	2b5uA.pdb.gz
17	PDB:6d7gA	0.045	0.122	6.474E-1	386	0.009	0.028	6d7gA.pdb.gz
18	PDB:5j6hA	0.041	0.142	6.816E-1	275	0.011	0.047	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
19	PDB:5njbB	0.035	0.079	7.176E-1	445	0.013	0.036	5njbB.pdb.gz	The Origins of Specificity in the Microcin-Processing Protease TldD/E.
20	PDB:7ungA0	0.091	0.371	7.554E-1	220	0.033	0.186	7ungA0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95239	0.0	2516	1232	1.000	1.000	KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3
2	P33174	0.0	2147	1231	0.872	0.872	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
3	Q2VIQ3	0.0	2296	1234	0.938	0.937	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
4	Q9XZ29	0.0	577	1212	0.343	0.349	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
5	Q6YUL8	4.57e-174	544	1035	0.300	0.357	KN4A_ORYSJ Kinesin-like protein KIN-4A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN4A PE=1 SV=1
6	A0A068FIK2	1.19e-168	530	1033	0.291	0.348	KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium hirsutum OX=3635 GN=KIN4A PE=2 SV=1
7	Q8GS71	6.12e-166	523	1035	0.291	0.346	KN4A_ARATH Kinesin-like protein KIN-4A OS=Arabidopsis thaliana OX=3702 GN=KIN4A PE=1 SV=1
8	F4K0J3	7.62e-160	514	1300	0.282	0.267	KN4C_ARATH Kinesin-like protein KIN-4C OS=Arabidopsis thaliana OX=3702 GN=KIN4C PE=2 SV=2
9	O45935	1.70e-128	424	1083	0.250	0.284	KLP19_CAEEL Kinesin-like protein klp-19 OS=Caenorhabditis elegans OX=6239 GN=klp-19 PE=2 SV=1
10	Q9QXL1	1.04e-112	390	1668	0.172	0.127	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
11	O75037	2.55e-112	388	1637	0.172	0.130	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
12	Q7Z4S6	4.91e-110	382	1674	0.173	0.127	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
13	A0A1B0GV47	5.52e-110	382	1653	0.173	0.129	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
14	Q86VH2	1.22e-105	366	1401	0.147	0.129	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
15	Q7M6Z4	1.41e-104	363	1394	0.144	0.128	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
16	Q58G59	3.89e-96	338	1363	0.140	0.126	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
17	B7ZNG0	1.29e-94	334	1348	0.137	0.125	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
18	Q2M1P5	1.44e-94	334	1343	0.138	0.127	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
19	P46873	7.54e-94	318	699	0.143	0.252	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
20	A0A0G2JUD6	2.77e-89	306	701	0.140	0.245	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	4e-112	386.1	Kinesin motor domain
2	PF16796 Microtub_bd	1.2e-17	75.8	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377793	0.997	Protein regulator of cytokinesis 1
2	9606.ENSP00000411532	0.991	DNA topoisomerase 2-alpha
3	9606.ENSP00000302530	0.990	Mitotic checkpoint serine/threonine-protein kinase BUB1
4	9606.ENSP00000404190	0.985	Rac GTPase-activating protein 1
5	9606.ENSP00000260731	0.984	Kinesin-like protein KIF11
6	9606.ENSP00000300403	0.983	Targeting protein for Xklp2
7	9606.ENSP00000260363	0.982	Kinesin-like protein KIF23
8	9606.ENSP00000356379	0.982	Abnormal spindle-like microcephaly-associated protein
9	9606.ENSP00000378699	0.982	Cyclin-dependent kinase 1
10	9606.ENSP00000378356	0.977	Kinesin-like protein KIF20A
11	9606.ENSP00000287598	0.975	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
12	9606.ENSP00000300093	0.973	Serine/threonine-protein kinase PLK1
13	9606.ENSP00000216911	0.970	Aurora kinase A
14	9606.ENSP00000313950	0.970	Aurora kinase B
15	9606.ENSP00000361540	0.970	Cell division cycle protein 20 homolog
16	9606.ENSP00000247191	0.969	Disks large-associated protein 5
17	9606.ENSP00000265148	0.969	Centromere-associated protein E
18	9606.ENSP00000288207	0.966	G2/mitotic-specific cyclin-B2
19	9606.ENSP00000301633	0.962	Baculoviral IAP repeat containing 5
20	9606.ENSP00000361298	0.958	Kinesin-like protein KIF2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	1.000	ATP-dependent activity
GO:0003774	1.000	cytoskeletal motor activity
GO:0005515	1.000	protein binding
GO:0003777	0.989	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0016043	0.976	cellular component organization
GO:0007017	0.961	microtubule-based process
GO:0061640	0.942	cytoskeleton-dependent cytokinesis
GO:0051225	0.939	spindle assembly
GO:1903047	0.936	mitotic cell cycle process
GO:0000281	0.932	mitotic cytokinesis
GO:0000070	0.907	mitotic sister chromatid segregation
GO:1902850	0.873	microtubule cytoskeleton organization involved in mitosis
GO:0051179	0.830	localization
GO:0007052	0.816	mitotic spindle organization
GO:0090307	0.638	mitotic spindle assembly
GO:0051231	0.632	spindle elongation
GO:0050789	0.619	regulation of biological process
GO:0050794	0.586	regulation of cellular process
GO:0099111	0.579	microtubule-based transport
GO:0030705	0.556	cytoskeleton-dependent intracellular transport
GO:0000022	0.515	mitotic spindle elongation
GO:0007018	0.355	microtubule-based movement
GO:0010970	0.332	transport along microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.996	intracellular organelle
GO:0005654	0.979	nucleoplasm
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0032991	0.688	protein-containing complex
GO:0016020	0.342	membrane
GO:0015630	0.336	microtubule cytoskeleton
GO:0099080	0.303	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]