StarFunc result for job id O95243

User Input

>input (580 residues)
MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSE
CNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRS
KSSLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRT
RSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKG
IPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETL
SVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGT
KVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSS
KYNKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWK
FLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKY
GNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95243	1.000	1.000	2.027E-78	580	1.000	1.000	O95243.pdb.gz	MBD4_HUMAN Methyl-CpG-binding domain protein 4 OS=Homo sapiens OX=9606 GN=MBD4 PE=1 SV=1
2	AFDB:D4A9W8	0.432	0.441	2.379E-55	566	0.657	0.673	D4A9W8.pdb.gz	D4A9W8_RAT Methyl-CpG-binding domain protein 4 OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=4
3	AFDB:Q9Z2D7	0.500	0.520	2.288E-54	554	0.652	0.682	Q9Z2D7.pdb.gz	MBD4_MOUSE Methyl-CpG-binding domain protein 4 OS=Mus musculus OX=10090 GN=Mbd4 PE=1 SV=1
4	AFDB:A0A140VKC4	0.111	0.128	7.216E-8	498	0.164	0.191	A0A140VKC4.pdb.gz	A0A140VKC4_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=2 SV=1
5	PDB:4yprA	0.161	0.253	7.974E-5	355	0.057	0.093	4yprA.pdb.gz	Structural Basis for Avoidance of Promutagenic DNA Repair by MutY Adenine DNA Glycosylase.
6	PDB:7ao8C	0.091	0.716	2.277E-4	64	0.043	0.391	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
7	PDB:2abkA	0.163	0.413	3.407E-3	211	0.041	0.114	2abkA.pdb.gz	Novel DNA binding motifs in the DNA repair enzyme endonuclease III crystal structure.
8	PDB:4b21A	0.151	0.379	3.102E-2	207	0.034	0.097	4b21A.pdb.gz	Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
9	PDB:3s6iD	0.149	0.379	4.565E-2	207	0.034	0.097	3s6iD.pdb.gz	Analysis of substrate specificity of Schizosaccharomyces pombe Mag1 alkylpurine DNA glycosylase.
10	PDB:6g3yA	0.160	0.281	6.719E-2	316	0.040	0.073	6g3yA.pdb.gz	Small-molecule inhibitor of OGG1 suppresses proinflammatory gene expression and inflammation.
11	AFDB:A9SY39	0.079	0.064	9.941E-2	759	0.090	0.069	A9SY39.pdb.gz	M3K1A_PHYPA Mitogen-activated protein kinase kinase kinase 1a OS=Physcomitrium patens OX=3218 GN=MEKK1a PE=2 SV=2
12	PDB:2xhiA	0.155	0.270	1.104E-1	316	0.036	0.066	2xhiA.pdb.gz	Separation-of-Function Mutants Unravel the Dual- Reaction Mode of Human 8-Oxoguanine DNA Glycosylase.
13	AFDB:Q86IH1	0.082	0.069	1.727E-1	740	0.126	0.099	Q86IH1.pdb.gz	HBX4_DICDI Homeobox protein 4 OS=Dictyostelium discoideum OX=44689 GN=hbx4 PE=3 SV=1
14	AFDB:Q9W2F0	0.057	0.045	1.727E-1	835	0.103	0.072	Q9W2F0.pdb.gz	Q9W2F0_DROME LD45439p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10321 PE=2 SV=1
15	AFDB:Q9Y6F6	0.068	0.050	1.825E-1	904	0.147	0.094	Q9Y6F6.pdb.gz	IRAG1_HUMAN Inositol 1,4,5-triphosphate receptor associated 1 OS=Homo sapiens OX=9606 GN=IRAG1 PE=1 SV=4
16	AFDB:Q7K4D1	0.071	0.053	3.170E-1	838	0.110	0.076	Q7K4D1.pdb.gz	Q7K4D1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=POSH PE=1 SV=1
17	AFDB:Q2TAV5	0.067	0.049	4.930E-1	902	0.093	0.060	Q2TAV5.pdb.gz	Q2TAV5_XENLA CBTF122 protein OS=Xenopus laevis OX=8355 GN=ilf3.S PE=2 SV=1
18	PDB:1m0uA	0.061	0.127	1.123	203	0.022	0.064	1m0uA.pdb.gz	Structure of a Drosophila Sigma Class Glutathione S-transferase Reveals a Novel Active Site Topography Suited for Lipid Peroxidation Products
19	PDB:6rq7B	0.094	0.109	1.187	479	0.016	0.019	6rq7B.pdb.gz	Controlled dehydration, structural flexibility and gadolinium MRI contrast compound binding in the human plasma glycoprotein afamin.
20	PDB:2jyoA	0.049	0.245	1.480	70	0.021	0.171	2jyoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AH85	0.0	685	590	0.666	0.654	A0A8I6AH85_RAT Methyl-CpG binding domain 4 DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=1
2	D4A9W8	0.0	678	549	0.636	0.672	D4A9W8_RAT Methyl-CpG-binding domain protein 4 OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=4
3	O95243	0.0	1201	580	1.000	1.000	MBD4_HUMAN Methyl-CpG-binding domain protein 4 OS=Homo sapiens OX=9606 GN=MBD4 PE=1 SV=1
4	Q9Z2D7	0.0	702	554	0.655	0.686	MBD4_MOUSE Methyl-CpG-binding domain protein 4 OS=Mus musculus OX=10090 GN=Mbd4 PE=1 SV=1
5	A0A8I5ZTJ7	5.86e-160	469	532	0.495	0.539	A0A8I5ZTJ7_RAT Methyl-CpG-binding domain protein 4 OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=1
6	Q9I9F1	2.16e-115	351	416	0.281	0.392	Q9I9F1_CHICK 5-methylcytosine G/T mismatch-specific DNA glycosylase OS=Gallus gallus OX=9031 PE=2 SV=1
7	Q00566	1.23e-15	82.0	492	0.067	0.079	MECP2_RAT Methyl-CpG-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Mecp2 PE=1 SV=1
8	Q9Z2D6	1.23e-15	82.0	484	0.067	0.081	MECP2_MOUSE Methyl-CpG-binding protein 2 OS=Mus musculus OX=10090 GN=Mecp2 PE=1 SV=1
9	D3YJ43	1.36e-15	82.0	486	0.067	0.080	D3YJ43_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=2 SV=1
10	P51608	1.36e-15	82.0	486	0.067	0.080	MECP2_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=1 SV=1
11	A0A140VKC4	1.43e-15	82.0	498	0.067	0.078	A0A140VKC4_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=2 SV=1
12	A8WIP2	1.68e-14	78.6	523	0.081	0.090	A8WIP2_DANRE Methyl-CpG-binding protein 2 OS=Danio rerio OX=7955 GN=wu:fk96a04 PE=4 SV=1
13	Q7T2T7	1.73e-14	78.6	524	0.081	0.090	Q7T2T7_DANRE Methyl-CpG-binding protein 2 OS=Danio rerio OX=7955 GN=wu:fk96a04 PE=2 SV=2
14	O95983	1.06e-05	50.1	291	0.050	0.100	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
15	Q9Z2D8	1.11e-05	49.7	285	0.050	0.102	MBD3_MOUSE Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1
16	Q9UBB5	2.36e-05	49.3	411	0.045	0.063	MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
17	Q9Z2E1	3.71e-05	48.9	414	0.045	0.063	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
18	D4A986	3.73e-05	48.9	412	0.045	0.063	D4A986_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=3
19	B0BNM2	3.80e-05	48.5	412	0.045	0.063	B0BNM2_RAT Mbd2 protein OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=2 SV=1
20	X6RBL6	5.74e-05	47.4	241	0.045	0.108	X6RBL6_HUMAN Methyl-CpG binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00730 HhH-GPD	0.95	21.3	HhH-GPD superfamily base excision DNA repair protein
2	PF01429 MBD	2.6e-17	73.6	Methyl-CpG binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231790	0.993	DNA mismatch repair protein Mlh1
2	9606.ENSP00000430598	0.904	Copper transport protein ATOX1
3	9606.ENSP00000301838	0.874	FAS-associated death domain protein
4	9606.ENSP00000376611	0.870	G/T mismatch-specific thymine DNA glycosylase
5	9606.ENSP00000343535	0.861	Ubiquitin carboxyl-terminal hydrolase 7
6	9606.ENSP00000424191	0.859	Single-strand selective monofunctional uracil DNA glycosylase
7	9606.ENSP00000216714	0.855	DNA-(apurinic or apyrimidinic site) lyase
8	9606.ENSP00000360025	0.840	Growth arrest and DNA damage-inducible protein GADD45 alpha
9	9606.ENSP00000352516	0.826	DNA (cytosine-5)-methyltransferase 1
10	9606.ENSP00000328547	0.808	DNA (cytosine-5)-methyltransferase 3B
11	9606.ENSP00000242839	0.748	Copper-transporting ATPase 2
12	9606.ENSP00000242576	0.725	Uracil-DNA glycosylase
13	9606.ENSP00000314153	0.723	Transcriptional regulator Kaiso
14	9606.ENSP00000229335	0.698	Single-stranded DNA cytosine deaminase
15	9606.ENSP00000367030	0.683	tRNA (cytosine(38)-C(5))-methyltransferase
16	9606.ENSP00000254521	0.673	3-keto-steroid reductase
17	9606.ENSP00000347170	0.672	Endonuclease 8-like 1
18	9606.ENSP00000366404	0.662	Zinc finger protein RFP
19	9606.ENSP00000347896	0.654	Methyl-CpG-binding domain protein 6
20	9606.ENSP00000264709	0.650	DNA (cytosine-5)-methyltransferase 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003690	0.999	double-stranded DNA binding
GO:0043565	0.998	sequence-specific DNA binding
GO:0019104	0.998	DNA N-glycosylase activity
GO:0004520	0.996	DNA endonuclease activity
GO:1990837	0.982	sequence-specific double-stranded DNA binding
GO:0008263	0.871	pyrimidine-specific mismatch base pair DNA N-glycosylase activity
GO:0003696	0.869	satellite DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006139	0.985	nucleobase-containing compound metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0050896	0.975	response to stimulus
GO:0006259	0.967	DNA metabolic process
GO:0043412	0.964	macromolecule modification
GO:0006304	0.942	DNA modification
GO:0006974	0.887	cellular response to DNA damage stimulus
GO:0009262	0.837	deoxyribonucleotide metabolic process
GO:0019692	0.836	deoxyribose phosphate metabolic process
GO:1901361	0.823	organic cyclic compound catabolic process
GO:0072527	0.796	pyrimidine-containing compound metabolic process
GO:0044270	0.781	cellular nitrogen compound catabolic process
GO:0046700	0.779	heterocycle catabolic process
GO:0019439	0.775	aromatic compound catabolic process
GO:0034655	0.769	nucleobase-containing compound catabolic process
GO:0072529	0.768	pyrimidine-containing compound catabolic process
GO:0006220	0.756	pyrimidine nucleotide metabolic process
GO:0009394	0.755	2'-deoxyribonucleotide metabolic process
GO:0009219	0.754	pyrimidine deoxyribonucleotide metabolic process
GO:0009166	0.746	nucleotide catabolic process
GO:0006281	0.744	DNA repair
GO:1901136	0.686	carbohydrate derivative catabolic process
GO:0065007	0.629	biological regulation
GO:0050789	0.615	regulation of biological process
GO:0050794	0.584	regulation of cellular process
GO:0006284	0.361	base-excision repair
GO:0048523	0.340	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.943	cytoplasm
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0016604	0.784	nuclear body
GO:0005694	0.783	chromosome
GO:0016607	0.555	nuclear speck
GO:0000785	0.528	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	0.999	Hydrolyzing N-glycosyl compounds.
EC:3.1.-.-	0.997	Acting on ester bonds.

[back to server]