StarFunc result for job id O95248

User Input

>input (1868 residues)
MARLADYFVLVAFGPHPRGSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPER
NPPTFFVAVLTDINSERHYCACLTFWEPAEPSQQETTRVEDATEREEEGDEGGQTHLSPT
APAPSAQLFAPKTLVLVSRLDHTEVFRNSLGLIYAIHVEGLNVCLENVIGNLLTCTVPLA
GGSQRTISLGAGDRQVIQTPLADSLPVSRCSVALLFRQLGITNVLSLFCAALTEHKVLFL
SRSYQRLADACRGLLALLFPLRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQEL
LDVIVADLDGGTVTIPECVHIPPLPEPLQSQTHSVLSMVLDPELELADLAFPPPTTSTSS
LKMQDKELRAVFLRLFAQLLQGYRWCLHVVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKV
LEGMAFAGFVSERGVPYRPTDLFDELVAHEVARMRADENHPQRVLRHVQELAEQLYKNEN
PYPAVAMHKVQRPGESSHLRRVPRPFPRLDEGTVQWIVDQAAAKMQGAPPAVKAERRTTV
PSGPPMTAILERCSGLHVNSARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARR
CLAQELHLHVQQNRAVLDHQQFDFVVRMMNCCLQDCTSLDEHGIAAALLPLVTAFCRKLS
PGVTQFAYSCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEPTEDLAPAQEVGEAPSQED
ERSALDVASEQRRLWPTLSREKQQELVQKEESTVFSQAIHYANRMSYLLLPLDSSKSRLL
RERAGLGDLESASNSLVTNSMAGSVAESYDTESGFEDAETCDVAGAVVRFINRFVDKVCT
ESGVTSDHLKGLHVMVPDIVQMHIETLEAVQRESRRLPPIQKPKLLRPRLLPGEECVLDG
LRVYLLPDGREEGAGGSAGGPALLPAEGAVFLTTYRVIFTGMPTDPLVGEQVVVRSFPVA
ALTKEKRISVQTPVDQLLQDGLQLRSCTFQLLKMAFDEEVGSDSAELFRKQLHKLRYPPD
IRATFAFTLGSAHTPGRPPRVTKDKGPSLRTLSRNLVKNAKKTIGRQHVTRKKYNPPSWE
HRGQPPPEDQEDEISVSEELEPSTLTPSSALKPSDRMTMSSLVERACCRDYQRLGLGTLS
SSLSRAKSEPFRISPVNRMYAICRSYPGLLIVPQSVQDNALQRVSRCYRQNRFPVVCWRS
GRSKAVLLRSGGLHGKGVVGLFKAQNAPSPGQSQADSSSLEQEKYLQAVVSSMPRYADAS
GRNTLSGFSSAHMGSHGKWGSVRTSGRSSGLGTDVGSRLAGRDALAPPQANGGPPDPGFL
RPQRAALYILGDKAQLKGVRSDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPAAEP
SPASFLRSLEDSEWLIQIHKLLQVSVLVVELLDSGSSVLVGLEDGWDITTQVVSLVQLLS
DPFYRTLEGFRLLVEKEWLSFGHRFSHRGAHTLAGQSSGFTPVFLQFLDCVHQVHLQFPM
EFEFSQFYLKFLGYHHVSRRFRTFLLDSDYERIELGLLYEEKGERRGQVPCRSVWEYVDR
LSKRTPVFHNYMYAPEDAEVLRPYSNVSNLKVWDFYTEETLAEGPPYDWELAQGPPEPPE
EERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVK
AAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGS
RQAARRSTSTLYSQFQTAESENRSYEGTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRV
DTECKGVIDLAEVEAVAPGTPTMGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDR
IQSCLSDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PXF8	0.772	0.771	0.000	1872	0.587	0.585	E9PXF8.pdb.gz	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
2	AFDB:M0RAP5	0.769	0.760	0.000	1893	0.951	0.939	M0RAP5.pdb.gz	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
3	AFDB:O95248	1.000	1.000	0.000	1868	1.000	1.000	O95248.pdb.gz	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
4	AFDB:Q86WG5	0.773	0.780	0.000	1849	0.590	0.596	Q86WG5.pdb.gz	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
5	AFDB:Q9VGH9	0.613	0.580	0.000	1993	0.429	0.402	Q9VGH9.pdb.gz	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
6	PDB:1lw3A	0.243	0.842	2.068E-27	513	0.088	0.320	1lw3A.pdb.gz
7	AFDB:Q9NYA4	0.242	0.370	3.559E-26	1195	0.097	0.151	Q9NYA4.pdb.gz	MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens OX=9606 GN=MTMR4 PE=1 SV=2
8	AFDB:Q13615	0.234	0.358	5.440E-26	1198	0.111	0.173	Q13615.pdb.gz	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
9	AFDB:G5EBF2	0.248	0.560	1.507E-25	782	0.085	0.203	G5EBF2.pdb.gz	G5EBF2_CAEEL phosphatidylinositol-3-phosphatase OS=Caenorhabditis elegans OX=6239 GN=mtm-6 PE=1 SV=1
10	AFDB:Q8MLR7	0.244	0.570	8.959E-25	761	0.079	0.193	Q8MLR7.pdb.gz	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
11	AFDB:Q8RXA7	0.211	0.322	2.940E-24	1187	0.090	0.142	Q8RXA7.pdb.gz	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
12	PDB:3ljuX	0.052	0.247	4.689E-4	373	0.012	0.059	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:6bbpA	0.049	0.173	1.355E-3	520	0.014	0.052	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	PDB:6u3eA	0.048	0.218	2.455E-3	397	0.014	0.068	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:4iapA	0.041	0.274	3.752E-3	256	0.012	0.086	4iapA.pdb.gz
16	PDB:5yqrA	0.048	0.298	1.523E-2	268	0.011	0.078	5yqrA.pdb.gz
17	PDB:6hhgA	0.047	0.217	1.523E-2	386	0.011	0.052	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:6s9wA	0.048	0.206	2.138E-2	411	0.011	0.049	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:6xtbE	0.049	0.342	2.328E-2	235	0.013	0.102	6xtbE.pdb.gz
20	PDB:6nzdI	0.067	0.229	3.559E-2	388	0.032	0.155	6nzdI.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AD51	0.0	3567	1875	0.951	0.948	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
2	E9PXF8	0.0	2174	1872	0.591	0.590	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
3	H0Y5W8	0.0	879	425	0.228	1.000	H0Y5W8_HUMAN SET binding factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=2
4	M0RAP5	0.0	3559	1893	0.951	0.939	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
5	O95248	0.0	3835	1868	1.000	1.000	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
6	O96610	0.0	1033	1750	0.330	0.352	O96610_DROME SET domain binding factor OS=Drosophila melanogaster OX=7227 GN=Sbf PE=2 SV=1
7	Q6ZPE2	0.0	3569	1867	0.949	0.949	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
8	Q7KSP6	0.0	1318	1973	0.400	0.379	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
9	Q86WG5	0.0	2192	1849	0.599	0.605	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
10	Q960A9	0.0	1103	1728	0.339	0.366	Q960A9_DROME SD10541p OS=Drosophila melanogaster OX=7227 GN=Sbf PE=2 SV=1
11	Q9VGH9	0.0	1308	1993	0.402	0.377	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
12	Q13615	1.03e-48	193	1198	0.078	0.122	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
13	A0A8I6AT43	1.85e-45	182	1195	0.074	0.115	A0A8I6AT43_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
14	D3ZW40	1.85e-45	182	1191	0.074	0.116	D3ZW40_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=2
15	A0A8I6A3Q2	1.88e-45	182	1205	0.074	0.115	A0A8I6A3Q2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
16	A0A8I6AFY1	2.13e-45	182	1216	0.074	0.113	A0A8I6AFY1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
17	Q9NYA4	1.79e-44	179	1195	0.073	0.115	MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens OX=9606 GN=MTMR4 PE=1 SV=2
18	Q9Z2C4	2.17e-42	169	669	0.069	0.191	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
19	Q13613	2.76e-42	169	665	0.070	0.195	MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4
20	A0A8I5Y8V2	4.41e-38	159	1134	0.062	0.101	A0A8I5Y8V2_RAT Phosphatidylinositol-3-phosphate phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	0.012	27.0	dDENN domain
2	PF02141 DENN	2.3e-45	166.3	DENN (AEX-3) domain
3	PF02893 GRAM	4.1e-20	83.1	GRAM domain
4	PF06602 Myotub-related	2e-83	292.0	Myotubularin-like phosphatase domain
5	PF00169 PH	9.1e-10	50.3	PH domain
6	PF15413 PH_11	8.3	18.3	Pleckstrin homology domain
7	PF08458 PH_2	2.7e+02	13.3	Plant pleckstrin homology-like region
8	PF15409 PH_8	1.2e+02	14.3	Pleckstrin homology domain
9	PF12335 SBF2	1.6e-99	343.6	Myotubularin protein
10	PF08616 SPA	4.9	18.5	Stabilization of polarity axis
11	PF11612 T2SSJ	5.4e+02	12.2	Type II secretion system (T2SS), protein J
12	PF03456 uDENN	2.1e-16	71.4	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000044530

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000008881	0.846	RAB21, member RAS oncogene family
2	9598.ENSPTRP00000046198	0.845	Myotubularin related protein 2
3	9598.ENSPTRP00000016054	0.829	Myotubularin related protein 4
4	9598.ENSPTRP00000024518	0.819	Myotubularin related protein 3
5	9598.ENSPTRP00000038536	0.817	Myotubularin related protein 1
6	9598.ENSPTRP00000031582	0.700	Uncharacterized protein
7	9598.ENSPTRP00000037969	0.699	Substrate-binding subunit (component A) of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane.
8	9598.ENSPTRP00000046018	0.688	Uncharacterized protein
9	9598.ENSPTRP00000046175	0.680	Uncharacterized protein
10	9598.ENSPTRP00000027900	0.676	Uncharacterized protein
11	9598.ENSPTRP00000025082	0.671	Choline kinase beta
12	9598.ENSPTRP00000024894	0.668	Transcription factor 20 (AR1)
13	9598.ENSPTRP00000029723	0.667	Uncharacterized protein
14	9598.ENSPTRP00000024824	0.658	Small G protein signaling modulator 3
15	9598.ENSPTRP00000025033	0.652	Uncharacterized protein
16	9598.ENSPTRP00000034620	0.650	Hook homolog 3
17	9598.ENSPTRP00000025039	0.645	Uncharacterized protein
18	9598.ENSPTRP00000047203	0.638	Rab GDP dissociation inhibitor alpha
19	9598.ENSPTRP00000046835	0.637	Rab GDP dissociation inhibitor
20	9598.ENSPTRP00000040970	0.636	Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. TRX/MLL subfamily

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005085	0.998	guanyl-nucleotide exchange factor activity
GO:0003824	0.980	catalytic activity
GO:0042578	0.917	phosphoric ester hydrolase activity
GO:0016791	0.833	phosphatase activity
GO:0140096	0.773	catalytic activity, acting on a protein
GO:0008138	0.691	protein tyrosine/serine/threonine phosphatase activity
GO:0019899	0.467	enzyme binding
GO:0019208	0.458	phosphatase regulator activity
GO:0035091	0.306	phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0000003	0.989	reproduction
GO:0032501	0.948	multicellular organismal process
GO:0032502	0.929	developmental process
GO:0048232	0.910	male gamete generation
GO:0007283	0.832	spermatogenesis
GO:0008152	0.825	metabolic process
GO:0050794	0.817	regulation of cellular process
GO:0048856	0.762	anatomical structure development
GO:0071704	0.706	organic substance metabolic process
GO:0044237	0.630	cellular metabolic process
GO:0044238	0.625	primary metabolic process
GO:0006807	0.539	nitrogen compound metabolic process
GO:0048515	0.456	spermatid differentiation
GO:0007286	0.453	spermatid development
GO:0043170	0.424	macromolecule metabolic process
GO:1901564	0.361	organonitrogen compound metabolic process
GO:0006796	0.342	phosphate-containing compound metabolic process
GO:0036211	0.335	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.974	cytosol
GO:0043233	0.967	organelle lumen
GO:0031981	0.956	nuclear lumen
GO:0005654	0.947	nucleoplasm
GO:0016020	0.929	membrane
GO:0012505	0.781	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.917	Acting on ester bonds.
EC:3.1.3.-	0.833	Phosphoric monoester hydrolases.

[back to server]