StarFunc result for job id O95251

User Input

>input (611 residues)
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EUP3	0.464	0.665	5.400E-78	425	0.694	0.998	E7EUP3.pdb.gz	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
2	AFDB:Q9NHW0	0.535	0.419	7.212E-54	811	0.442	0.333	Q9NHW0.pdb.gz	Q9NHW0_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=chm PE=2 SV=1
3	AFDB:Q8WYB5	0.451	0.137	6.751E-41	2073	0.342	0.101	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
4	AFDB:Q9D1P2	0.433	0.573	9.567E-41	458	0.282	0.376	Q9D1P2.pdb.gz	KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus OX=10090 GN=Kat8 PE=1 SV=1
5	AFDB:Q9W1A9	0.434	0.120	2.036E-40	2291	0.347	0.093	Q9W1A9.pdb.gz	Q9W1A9_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=enok PE=1 SV=2
6	AFDB:Q10325	0.447	0.665	1.964E-39	407	0.264	0.396	Q10325.pdb.gz	MST2_SCHPO Histone acetyltransferase mst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mst2 PE=1 SV=1
7	AFDB:Q9FLF7	0.431	0.589	2.206E-39	445	0.273	0.375	Q9FLF7.pdb.gz	MYST1_ARATH Histone acetyltransferase of the MYST family 1 OS=Arabidopsis thaliana OX=3702 GN=HAM1 PE=1 SV=1
8	PDB:7cmrA	0.415	0.946	6.119E-39	263	0.252	0.586	7cmrA.pdb.gz	The Crystal Structure of human MYST1 from Biortus.
9	AFDB:Q9LXD7	0.431	0.589	8.896E-39	445	0.278	0.382	Q9LXD7.pdb.gz	MYST2_ARATH Histone acetyltransferase of the MYST family 2 OS=Arabidopsis thaliana OX=3702 GN=HAM2 PE=1 SV=1
10	AFDB:Q08649	0.442	0.603	1.336E-38	445	0.249	0.342	Q08649.pdb.gz	ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESA1 PE=1 SV=1
11	AFDB:Q960X4	0.434	0.490	1.416E-38	541	0.295	0.333	Q960X4.pdb.gz	TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster OX=7227 GN=Tip60 PE=1 SV=1
12	PDB:7vvuP	0.428	0.950	3.956E-35	270	0.237	0.537	7vvuP.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
13	PDB:5jq4B	0.153	0.524	1.897E-2	146	0.034	0.144	5jq4B.pdb.gz
14	PDB:6yugA	0.153	0.543	2.130E-2	143	0.036	0.154	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.
15	PDB:3t90A	0.141	0.478	2.393E-2	147	0.028	0.116	3t90A.pdb.gz
16	PDB:1s5kA	0.151	0.490	2.849E-2	153	0.029	0.118	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
17	PDB:4ua3B	0.134	0.365	3.019E-2	194	0.034	0.108	4ua3B.pdb.gz	The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
18	PDB:2b4bB	0.155	0.444	3.391E-2	170	0.026	0.094	2b4bB.pdb.gz	Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
19	PDB:4fx0B	0.102	0.356	4.534E-2	135	0.021	0.096	4fx0B.pdb.gz
20	PDB:2beiB	0.145	0.436	5.721E-2	159	0.039	0.151	2beiB.pdb.gz	Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EUP3	0.0	885	425	0.696	1.000	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
2	O95251	0.0	1278	611	1.000	1.000	KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
3	Q5SVQ0	0.0	1266	613	0.992	0.989	KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus OX=10090 GN=Kat7 PE=1 SV=1
4	Q7ZW29	0.0	937	568	0.771	0.829	Q7ZW29_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=myst2 PE=1 SV=1
5	Q9VM15	2.46e-161	483	811	0.385	0.290	Q9VM15_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=chm PE=3 SV=2
6	Q9NHW0	3.58e-161	483	811	0.385	0.290	Q9NHW0_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=chm PE=2 SV=1
7	Q7YTZ9	7.97e-157	462	538	0.373	0.424	Q7YTZ9_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=chm PE=2 SV=1
8	Q8BZ21	1.18e-115	382	2003	0.288	0.088	KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus OX=10090 GN=Kat6a PE=1 SV=2
9	Q5TKR9	1.41e-115	381	1998	0.288	0.088	KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus OX=10116 GN=Kat6a PE=1 SV=2
10	A0A3B3IS53	3.18e-115	379	1677	0.286	0.104	A0A3B3IS53_HUMAN Histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1
11	A0A3F2YNX6	3.26e-115	380	2006	0.286	0.087	A0A3F2YNX6_HUMAN Histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1
12	Q92794	3.54e-115	380	2004	0.286	0.087	KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2
13	Q9H7Z6	2.26e-114	351	458	0.262	0.349	KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8 PE=1 SV=2
14	Q8WYB5	2.67e-114	378	2073	0.283	0.083	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
15	Q7SXF3	3.11e-114	352	487	0.259	0.324	Q7SXF3_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=myst1 PE=1 SV=1
16	Q9D1P2	4.08e-114	350	458	0.262	0.349	KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus OX=10090 GN=Kat8 PE=1 SV=1
17	M0R4T9	5.62e-114	376	1857	0.285	0.094	M0R4T9_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat6b PE=3 SV=3
18	Q8BRB7	6.86e-114	376	1872	0.285	0.093	KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus OX=10090 GN=Kat6b PE=1 SV=3
19	A0A8I6GLZ3	9.83e-114	376	2039	0.285	0.085	A0A8I6GLZ3_RAT histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat6b PE=3 SV=1
20	A0A3B3ITI3	8.20e-113	371	1565	0.270	0.105	A0A3B3ITI3_HUMAN Histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13508 Acetyltransf_7	1.1e+02	14.5	Acetyltransferase (GNAT) domain
2	PF01853 MOZ_SAS	3.1e-83	289.3	MOZ/SAS family
3	PF01530 zf-C2HC	5.6e-10	50.5	Zinc finger, C2HC type
4	PF12874 zf-met	3.1e+02	13.2	Zinc-finger of C2H2 type
5	PF17772 zf-MYST	9.7e-20	81.3	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007465137.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007453960.1	0.996	Bromodomain containing 1
2	118797.XP_007470026.1	0.991	Inhibitor of growth protein 5
3	118797.XP_007467329.1	0.985	Bromodomain and PHD finger-containing protein 3
4	118797.XP_007469476.1	0.984	Inhibitor of growth family member 4
5	118797.XP_007453868.1	0.983	MYST/Esa1 associated factor 6
6	118797.XP_007451586.1	0.967	Bromodomain and PHD finger containing 1
7	118797.XP_007457047.1	0.967	Jade family PHD finger 1
8	118797.XP_007461425.1	0.938	Jade family PHD finger 2
9	118797.XP_007448925.1	0.920	Belongs to the PI3/PI4-kinase family.
10	118797.XP_007458390.1	0.917	Mortality factor 4-like protein 1 isoform X1
11	118797.XP_007463615.1	0.916	YEATS domain-containing protein 4
12	118797.XP_007465332.1	0.909	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
13	118797.XP_007468329.1	0.909	DNA methyltransferase 1 associated protein 1
14	118797.XP_007450894.1	0.903	Jade family PHD finger 3
15	118797.XP_007449308.1	0.898	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
16	118797.XP_007471299.1	0.898	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
17	118797.XP_007462316.1	0.886	MRG/MORF4L-binding protein
18	118797.XP_007463398.1	0.884	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
19	118797.XP_007459394.1	0.872	Inhibitor of growth family member 3
20	118797.XP_007465249.1	0.867	Male specific lethal 1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0010484	0.999	histone H3 acetyltransferase activity
GO:0005515	0.995	protein binding
GO:0140110	0.841	transcription regulator activity
GO:0003712	0.668	transcription coregulator activity
GO:0010485	0.616	histone H4 acetyltransferase activity
GO:0097159	0.461	organic cyclic compound binding
GO:1901363	0.460	heterocyclic compound binding
GO:0003676	0.451	nucleic acid binding
GO:0003677	0.403	DNA binding
GO:0003713	0.372	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0009987	0.987	cellular process
GO:2001141	0.986	regulation of RNA biosynthetic process
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0010468	0.972	regulation of gene expression
GO:0045935	0.954	positive regulation of nucleobase-containing compound metabolic process
GO:0071840	0.935	cellular component organization or biogenesis
GO:0016043	0.929	cellular component organization
GO:1903506	0.918	regulation of nucleic acid-templated transcription
GO:0006355	0.910	regulation of DNA-templated transcription
GO:0071704	0.890	organic substance metabolic process
GO:0044238	0.886	primary metabolic process
GO:0006807	0.866	nitrogen compound metabolic process
GO:0006325	0.864	chromatin organization
GO:0043170	0.845	macromolecule metabolic process
GO:0006338	0.767	chromatin remodeling
GO:0010628	0.616	positive regulation of gene expression
GO:0016570	0.614	histone modification
GO:0018193	0.587	peptidyl-amino acid modification
GO:0018205	0.573	peptidyl-lysine modification
GO:0050896	0.533	response to stimulus
GO:0006473	0.514	protein acetylation
GO:0031328	0.469	positive regulation of cellular biosynthetic process
GO:0010557	0.466	positive regulation of macromolecule biosynthetic process
GO:0048519	0.461	negative regulation of biological process
GO:0006357	0.429	regulation of transcription by RNA polymerase II
GO:0048523	0.418	negative regulation of cellular process
GO:0032502	0.402	developmental process
GO:0032501	0.395	multicellular organismal process
GO:0048856	0.385	anatomical structure development
GO:0009892	0.380	negative regulation of metabolic process
GO:0018394	0.375	peptidyl-lysine acetylation
GO:0010605	0.372	negative regulation of macromolecule metabolic process
GO:0031324	0.361	negative regulation of cellular metabolic process
GO:0006475	0.359	internal protein amino acid acetylation
GO:0016573	0.354	histone acetylation
GO:0051172	0.336	negative regulation of nitrogen compound metabolic process
GO:0045893	0.336	positive regulation of DNA-templated transcription
GO:0040029	0.322	epigenetic regulation of gene expression
GO:0051052	0.320	regulation of DNA metabolic process
GO:0051716	0.314	cellular response to stimulus
GO:0044237	0.302	cellular metabolic process
GO:0048583	0.300	regulation of response to stimulus
GO:0045934	0.300	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000123	0.997	histone acetyltransferase complex
GO:0005654	0.995	nucleoplasm
GO:0140513	0.992	nuclear protein-containing complex
GO:0070775	0.981	H3 histone acetyltransferase complex
GO:0005737	0.956	cytoplasm
GO:0005829	0.948	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	0.999	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.999	histone acetyltransferase.

[back to server]