StarFunc result for job id O95255

User Input

>input (1503 residues)
MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGR
GYLRMSPLFKAKMVLGFALIVLCTSSVAVALWKIQQGTPEAPEFLIHPTVWLTTMSFAVF
LIHTERKKGVQSSGVLFGYWLLCFVLPATNAAQQASGAGFQSDPVRHLSTYLCLSLVVAQ
FVLSCLADQPPFFPEDPQQSNPCPETGAAFPSKATFWWVSGLVWRGYRRPLRPKDLWSLG
RENSSEELVSRLEKEWMRNRSAARRHNKAIAFKRKGGSGMKAPETEPFLRQEGSQWRPLL
KAIWQVFHSTFLLGTLSLIISDVFRFTVPKLLSLFLEFIGDPKPPAWKGYLLAVLMFLSA
CLQTLFEQQNMYRLKVLQMRLRSAITGLVYRKVLALSSGSRKASAVGDVVNLVSVDVQRL
TESVLYLNGLWLPLVWIVVCFVYLWQLLGPSALTAIAVFLSLLPLNFFISKKRNHHQEEQ
MRQKDSRARLTSSILRNSKTIKFHGWEGAFLDRVLGIRGQELGALRTSGLLFSVSLVSFQ
VSTFLVALVVFAVHTLVAENAMNAEKAFVTLTVLNILNKAQAFLPFSIHSLVQARVSFDR
LVTFLCLEEVDPGVVDSSSSGSAAGKDCITIHSATFAWSQESPPCLHRINLTVPQGCLLA
VVGPVGAGKSSLLSALLGELSKVEGFVSIEGAVAYVPQEAWVQNTSVVENVCFGQELDPP
WLERVLEACALQPDVDSFPEGIHTSIGEQGMNLSGGQKQRLSLARAVYRKAAVYLLDDPL
AALDAHVGQHVFNQVIGPGGLLQGTTRILVTHALHILPQADWIIVLANGAIAEMGSYQEL
LQRKGALMCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRT
TSEAQTEVPLDDPDRAGWPAGKDSIQYGRVKATVHLAYLRAVGTPLCLYALFLFLCQQVA
SFCRGYWLSLWADDPAVGGQQTQAALRGGIFGLLGCLQAIGLFASMAAVLLGGARASRLL
FQRLLWDVVRSPISFFERTPIGHLLNRFSKETDTVDVDIPDKLRSLLMYAFGLLEVSLVV
AVATPLATVAILPLFLLYAGFQSLYVVSSCQLRRLESASYSSVCSHMAETFQGSTVVRAF
RTQAPFVAQNNARVDESQRISFPRLVADRWLAANVELLGNGLVFAAATCAVLSKAHLSAG
LVGFSVSAALQVTQTLQWVVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWP
QGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAE
GGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQL
KALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQM
QAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQES
GLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IC81	0.928	0.919	0.000	1518	0.456	0.451	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
2	AFDB:A7KVC2	0.812	0.808	0.000	1510	0.293	0.291	A7KVC2.pdb.gz	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
3	AFDB:B2RX12	0.872	0.862	0.000	1523	0.420	0.414	B2RX12.pdb.gz	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
4	AFDB:E7F118	0.888	0.886	0.000	1507	0.474	0.473	E7F118.pdb.gz	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
5	AFDB:G5EFP3	0.870	0.833	0.000	1573	0.351	0.335	G5EFP3.pdb.gz	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
6	AFDB:O15438	0.898	0.884	0.000	1527	0.430	0.424	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
7	AFDB:O88269	0.957	0.957	0.000	1502	0.786	0.787	O88269.pdb.gz	MRP6_RAT ATP-binding cassette sub-family C member 6 OS=Rattus norvegicus OX=10116 GN=Abcc6 PE=1 SV=1
8	AFDB:O95255	1.000	1.000	0.000	1503	1.000	1.000	O95255.pdb.gz	MRP6_HUMAN ATP-binding cassette sub-family C member 6 OS=Homo sapiens OX=9606 GN=ABCC6 PE=1 SV=2
9	AFDB:P33527	0.912	0.896	0.000	1531	0.454	0.445	P33527.pdb.gz	MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3
10	AFDB:P39109	0.835	0.829	0.000	1515	0.340	0.337	P39109.pdb.gz	YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCF1 PE=1 SV=2
11	PDB:7mpeA	0.748	0.782	4.933E-95	1428	0.335	0.352	7mpeA.pdb.gz
12	PDB:6jb1B	0.722	0.789	2.408E-86	1366	0.289	0.318	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
13	PDB:7s5xE	0.737	0.780	2.306E-83	1412	0.293	0.312	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
14	PDB:5ykfB	0.711	0.807	4.543E-82	1309	0.289	0.332	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
15	PDB:7vluA	0.699	0.893	2.207E-81	1159	0.260	0.337	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
16	PDB:6c3pE	0.719	0.789	7.153E-78	1359	0.288	0.319	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
17	PDB:6c3oE	0.652	0.753	2.319E-74	1290	0.285	0.332	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
18	PDB:7mitE	0.739	0.769	1.770E-72	1438	0.287	0.300	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
19	PDB:6msmA	0.658	0.821	2.544E-70	1181	0.216	0.275	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
20	PDB:5w81A	0.684	0.861	1.237E-67	1173	0.232	0.297	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	1117	1215	0.379	0.469	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	625	1408	0.293	0.312	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	601	1557	0.299	0.288	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	1347	1518	0.463	0.458	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	991	1492	0.383	0.386	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1S4NYG1	587	1582	0.283	0.269	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
7	A0A1U7R319	587	1582	0.283	0.269	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
8	A0A1U8QTJ9	641	1396	0.291	0.314	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
9	A7KVC2	642	1510	0.291	0.290	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RX12	1218	1523	0.430	0.424	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
11	E7F118	1403	1507	0.484	0.483	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
12	E9Q236	691	1325	0.294	0.334	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
13	F1LR52	677	1288	0.282	0.329	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
14	F1M3J4	691	1325	0.294	0.334	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
15	G5EFP3	864	1573	0.365	0.349	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
16	I3L4X2	1271	1440	0.435	0.454	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
17	O15438	1193	1527	0.438	0.431	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
18	O15439	692	1325	0.290	0.329	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
19	O35379	1321	1528	0.455	0.448	MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Abcc1 PE=1 SV=1
20	O60706	584	1549	0.309	0.300	ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens OX=9606 GN=ABCC9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	0.0043	28.9	AAA ATPase domain
2	PF13238 AAA_18	86	15.1	AAA domain
3	PF13304 AAA_21	0.11	23.9	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	0.15	23.8	AAA domain
5	PF13476 AAA_23	2.7e+02	13.5	AAA domain
6	PF13481 AAA_25	3	18.9	AAA domain
7	PF13555 AAA_29	0.6	21.2	P-loop containing region of AAA domain
8	PF13671 AAA_33	4.3e+02	12.5	AAA domain
9	PF12775 AAA_7	3.4e+02	12.2	P-loop containing dynein motor region
10	PF08298 AAA_PrkA	5.4e+02	10.9	PrkA AAA domain
11	PF09818 ABC_ATPase	3.5e+02	11.6	ATPase of the ABC class
12	PF00664 ABC_membrane	4.9e-54	195.4	ABC transporter transmembrane region
13	PF00005 ABC_tran	5.4e-51	184.1	ABC transporter
14	PF01935 DUF87	3.4e+02	12.7	Helicase HerA, central domain
15	PF00350 Dynamin_N	20	16.7	Dynamin family
16	PF01926 MMR_HSR1	0.0035	28.8	50S ribosome-binding GTPase
17	PF16185 MTABC_N	0.71	20.9	Mitochondrial ABC-transporter N-terminal five TM region
18	PF00931 NB-ARC	2.9e+02	12.0	NB-ARC domain
19	PF03193 RsgA_GTPase	0.19	23.1	RsgA GTPase
20	PF02463 SMC_N	7.7e-05	33.8	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000205557

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233838	0.792	Vitamin K-dependent gamma-carboxylase
2	9606.ENSP00000261381	0.770	Xylosyltransferase 1
3	9606.ENSP00000228938	0.769	Matrix Gla protein
4	9606.ENSP00000354238	0.749	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
5	9606.ENSP00000378426	0.729	Vitamin K epoxide reductase complex subunit 1
6	9606.ENSP00000308976	0.704	Von Willebrand factor C domain-containing protein 2-like
7	9606.ENSP00000477502	0.694	Nodal modulator 2
8	9606.ENSP00000017003	0.682	Xylosyltransferase 2
9	9606.ENSP00000245539	0.659	Mitochondrial ribosomal protein S7
10	9606.ENSP00000260947	0.642	BRCA1-associated RING domain protein 1
11	9606.ENSP00000260645	0.595	ATP-binding cassette sub-family G member 5
12	9606.ENSP00000382274	0.584	Nodal modulator 3
13	9606.ENSP00000325546	0.547	Zinc finger protein PLAG1
14	9606.ENSP00000255759	0.546	LisH domain-containing protein FOPNL
15	9606.ENSP00000393887	0.543	Alpha-2-HS-glycoprotein
16	9606.ENSP00000258888	0.534	Alpha-protein kinase 3
17	9606.ENSP00000379654	0.525	Meiosis regulator and mRNA stability factor 1
18	9606.ENSP00000379669	0.520	Mpv17-like protein
19	9606.ENSP00000353734	0.519	Zinc finger protein PLAGL1
20	9606.ENSP00000379616	0.501	Myosin-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015103	0.999	inorganic anion transmembrane transporter activity
GO:0140359	0.999	ABC-type transporter activity
GO:0005524	0.998	ATP binding
GO:1901682	0.972	sulfur compound transmembrane transporter activity
GO:0003824	0.950	catalytic activity
GO:0042910	0.903	xenobiotic transmembrane transporter activity
GO:0005515	0.839	protein binding
GO:0016462	0.745	pyrophosphatase activity
GO:0017111	0.725	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.678	ATP hydrolysis activity
GO:0008559	0.593	ABC-type xenobiotic transporter activity
GO:0043225	0.570	ATPase-coupled inorganic anion transmembrane transporter activity
GO:0015431	0.566	ABC-type glutathione S-conjugate transporter activity
GO:0008514	0.530	organic anion transmembrane transporter activity
GO:0046943	0.381	carboxylic acid transmembrane transporter activity
GO:0015562	0.312	efflux transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051234	0.987	establishment of localization
GO:0006810	0.984	transport
GO:0015711	0.943	organic anion transport
GO:0009987	0.935	cellular process
GO:0008152	0.813	metabolic process
GO:0055085	0.785	transmembrane transport
GO:0050896	0.754	response to stimulus
GO:0055062	0.732	phosphate ion homeostasis
GO:0071704	0.723	organic substance metabolic process
GO:0042221	0.640	response to chemical
GO:0071705	0.596	nitrogen compound transport
GO:0044237	0.570	cellular metabolic process
GO:0015867	0.570	ATP transport
GO:0006807	0.475	nitrogen compound metabolic process
GO:0065007	0.457	biological regulation
GO:0044238	0.408	primary metabolic process
GO:0050789	0.390	regulation of biological process
GO:1901564	0.383	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098590	0.970	plasma membrane region
GO:0009925	0.948	basal plasma membrane
GO:0016323	0.936	basolateral plasma membrane
GO:0043227	0.835	membrane-bounded organelle
GO:0043229	0.828	intracellular organelle
GO:0043231	0.782	intracellular membrane-bounded organelle
GO:0005737	0.726	cytoplasm
GO:0070013	0.378	intracellular organelle lumen
GO:0031981	0.316	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.
EC:3.6.1.-	0.745	In phosphorus-containing anhydrides.
RHEA:23680	0.725	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.725	nucleoside-triphosphate phosphatase.
RHEA:13065	0.678	ATP + H2O = ADP + H(+) + phosphate
EC:7.6.2.2	0.593	ABC-type xenobiotic transporter.
RHEA:19121	0.566	an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate
EC:7.6.2.3	0.566	ABC-type glutathione-S-conjugate transporter.

[back to server]