StarFunc result for job id O95257

User Input

>input (159 residues)
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95257	1.000	1.000	7.053E-31	159	1.000	1.000	O95257.pdb.gz	GA45G_HUMAN Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Homo sapiens OX=9606 GN=GADD45G PE=1 SV=1
2	PDB:2walA	0.860	0.914	1.434E-23	149	0.931	0.993	2walA.pdb.gz
3	AFDB:F1R8Z0	0.896	0.907	1.411E-19	157	0.560	0.567	F1R8Z0.pdb.gz	F1R8Z0_DANRE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Danio rerio OX=7955 GN=gadd45al PE=3 SV=1
4	AFDB:P24522	0.888	0.857	6.472E-19	165	0.566	0.545	P24522.pdb.gz	GA45A_HUMAN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
5	AFDB:Q6PC51	0.885	0.885	7.873E-18	159	0.522	0.522	Q6PC51.pdb.gz	Q6PC51_DANRE Gadd45b protein OS=Danio rerio OX=7955 GN=gadd45b PE=2 SV=1
6	AFDB:O75293	0.875	0.870	1.539E-17	160	0.553	0.550	O75293.pdb.gz	GA45B_HUMAN Growth arrest and DNA damage-inducible protein GADD45 beta OS=Homo sapiens OX=9606 GN=GADD45B PE=1 SV=1
7	AFDB:Q5NU21	0.844	0.849	7.062E-17	158	0.547	0.551	Q5NU21.pdb.gz	Q5NU21_DANRE Gadd45b1 protein OS=Danio rerio OX=7955 GN=gadd45bl PE=2 SV=1
8	PDB:2kg4A	0.777	0.751	3.923E-16	165	0.579	0.558	2kg4A.pdb.gz
9	AFDB:A0A087WZQ0	0.678	0.729	1.305E-11	147	0.497	0.537	A0A087WZQ0.pdb.gz	A0A087WZQ0_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
10	AFDB:A1Z6W5	0.739	0.721	9.296E-10	163	0.252	0.245	A1Z6W5.pdb.gz	A1Z6W5_DROME FI09246p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
11	AFDB:P25398	0.582	0.688	1.250E-5	132	0.214	0.258	P25398.pdb.gz	RS12_HUMAN Small ribosomal subunit protein eS12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3
12	AFDB:Q38AC1	0.575	0.636	5.398E-5	142	0.208	0.232	Q38AC1.pdb.gz	Q38AC1_TRYB2 40S ribosomal protein S12 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2050 PE=3 SV=1
13	PDB:6fecr	0.487	0.600	1.957E-4	124	0.201	0.258	6fecr.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
14	PDB:5y7mA	0.583	0.725	2.497E-4	125	0.113	0.144	5y7mA.pdb.gz	Crystal structures of the archaeal RNase P protein Rpp38 in complex with RNA fragments containing a K-turn motif.
15	PDB:2aleA	0.585	0.691	4.593E-4	132	0.132	0.159	2aleA.pdb.gz	Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
16	PDB:5fciC2	0.511	0.635	1.146E-3	124	0.170	0.218	5fciC2.pdb.gz	?
17	PDB:4v6wAM	0.525	0.676	1.462E-3	119	0.170	0.227	4v6wAM.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:3sivA	0.576	0.701	1.652E-3	128	0.132	0.164	3sivA.pdb.gz	Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
19	PDB:5ndvC2	0.485	0.714	1.755E-3	102	0.151	0.235	5ndvC2.pdb.gz	Aminoglycoside interactions and impacts on the eukaryotic ribosome.
20	PDB:6faiM	0.524	0.643	4.379E-3	125	0.164	0.208	6faiM.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95257	1.98e-115	325	159	1.000	1.000	GA45G_HUMAN Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Homo sapiens OX=9606 GN=GADD45G PE=1 SV=1
2	Q9Z111	3.29e-109	309	159	0.956	0.956	GA45G_MOUSE Growth arrest and DNA damage-inducible protein GADD45 gamma OS=Mus musculus OX=10090 GN=Gadd45g PE=1 SV=1
3	F1R8Z0	2.15e-59	183	157	0.572	0.580	F1R8Z0_DANRE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Danio rerio OX=7955 GN=gadd45al PE=3 SV=1
4	P24522	4.52e-58	180	165	0.572	0.552	GA45A_HUMAN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
5	O75293	4.00e-57	177	160	0.560	0.556	GA45B_HUMAN Growth arrest and DNA damage-inducible protein GADD45 beta OS=Homo sapiens OX=9606 GN=GADD45B PE=1 SV=1
6	P48316	5.23e-57	177	165	0.566	0.545	GA45A_MOUSE Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Mus musculus OX=10090 GN=Gadd45a PE=1 SV=1
7	Q5NU21	6.17e-56	174	158	0.553	0.557	Q5NU21_DANRE Gadd45b1 protein OS=Danio rerio OX=7955 GN=gadd45bl PE=2 SV=1
8	P22339	1.84e-55	173	160	0.541	0.537	GA45B_MOUSE Growth arrest and DNA damage-inducible protein GADD45 beta OS=Mus musculus OX=10090 GN=Gadd45b PE=1 SV=1
9	P48317	7.32e-55	172	165	0.553	0.533	GA45A_RAT Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Rattus norvegicus OX=10116 GN=Gadd45a PE=2 SV=1
10	Q6PC51	1.15e-53	169	159	0.535	0.535	Q6PC51_DANRE Gadd45b protein OS=Danio rerio OX=7955 GN=gadd45b PE=2 SV=1
11	A0A087WZQ0	8.30e-45	145	147	0.503	0.544	A0A087WZQ0_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
12	A1Z6W5	5.09e-11	59.7	163	0.182	0.178	A1Z6W5_DROME FI09246p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
13	Q8MYS8	5.53e-11	59.7	163	0.182	0.178	Q8MYS8_DROME RH70774p OS=Drosophila melanogaster OX=7227 GN=Gadd45 PE=2 SV=1
14	A5JUZ3	1.35e-05	42.7	60	0.157	0.417	A5JUZ3_HUMAN Growth arrest and DNA damage inducible alpha OS=Homo sapiens OX=9606 GN=GADD45A PE=1 SV=1
15	Q03253	0.61	31.6	144	0.157	0.174	RS12_TRYBB Small ribosomal subunit protein eS12 OS=Trypanosoma brucei brucei OX=5702 GN=RPS12 PE=2 SV=2
16	Q9SHC8	1.4	31.2	239	0.119	0.079	VAP12_ARATH Vesicle-associated protein 1-2 OS=Arabidopsis thaliana OX=3702 GN=PVA12 PE=1 SV=1
17	P80455	1.6	30.4	139	0.151	0.173	RS12_DROME Small ribosomal subunit protein eS12 OS=Drosophila melanogaster OX=7227 GN=RpS12 PE=1 SV=2
18	Q9LY31	3.8	30.0	338	0.069	0.033	Q9LY31_ARATH AT3G60340 protein OS=Arabidopsis thaliana OX=3702 GN=F27H5_130 PE=1 SV=1
19	Q9M8J2	5.2	29.6	351	0.094	0.043	GATL4_ARATH Probable galacturonosyltransferase-like 4 OS=Arabidopsis thaliana OX=3702 GN=GATL4 PE=2 SV=1
20	G4SLH0	7.7	29.3	18562	0.145	0.001	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12854 PPR_1	8.8e+02	11.1	PPR repeat
2	PF01248 Ribosomal_L7Ae	6.1e-08	43.6	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252506

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375986	0.992	Mitogen-activated protein kinase kinase kinase 4
2	9606.ENSP00000378699	0.938	Cyclin-dependent kinase 1
3	9606.ENSP00000468348	0.937	Dual specificity mitogen-activated protein kinase kinase 6
4	9606.ENSP00000215631	0.935	Growth arrest and DNA damage-inducible protein GADD45 beta
5	9606.ENSP00000360025	0.928	Growth arrest and DNA damage-inducible protein GADD45 alpha
6	9606.ENSP00000345083	0.918	Dual specificity mitogen-activated protein kinase kinase 3
7	9606.ENSP00000368458	0.913	Proliferating cell nuclear antigen
8	9606.ENSP00000269305	0.912	Cellular tumor antigen p53
9	9606.ENSP00000256442	0.908	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000418693	0.879	RWD domain containing 2B
11	9606.ENSP00000288207	0.855	G2/mitotic-specific cyclin-B2
12	9606.ENSP00000365210	0.836	G2/mitotic-specific cyclin-B3
13	9606.ENSP00000323065	0.802	Growth arrest and DNA damage-inducible proteins-interacting protein 1
14	9606.ENSP00000296721	0.736	Actin filament-associated protein 1-like 1
15	9606.ENSP00000384849	0.697	Cyclin-dependent kinase inhibitor 1
16	9606.ENSP00000265171	0.660	Pro-epidermal growth factor
17	9606.ENSP00000393762	0.650	Sestrin-1
18	9606.ENSP00000345206	0.564	Recombining binding protein suppressor of hairless
19	9606.ENSP00000370224	0.536	Prostate androgen-regulated mucin-like protein 1
20	9606.ENSP00000448665	0.502	DNA damage-inducible transcript 3 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.470	identical protein binding
GO:0003676	0.431	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.994	positive regulation of biological process
GO:0009966	0.991	regulation of signal transduction
GO:0048522	0.984	positive regulation of cellular process
GO:1902531	0.949	regulation of intracellular signal transduction
GO:0048584	0.938	positive regulation of response to stimulus
GO:0009987	0.926	cellular process
GO:0050896	0.921	response to stimulus
GO:0043408	0.919	regulation of MAPK cascade
GO:0019222	0.905	regulation of metabolic process
GO:1902533	0.886	positive regulation of intracellular signal transduction
GO:0060255	0.885	regulation of macromolecule metabolic process
GO:0031323	0.882	regulation of cellular metabolic process
GO:0048519	0.879	negative regulation of biological process
GO:0080090	0.869	regulation of primary metabolic process
GO:0051171	0.866	regulation of nitrogen compound metabolic process
GO:0048523	0.866	negative regulation of cellular process
GO:0043410	0.845	positive regulation of MAPK cascade
GO:0043065	0.834	positive regulation of apoptotic process
GO:0080135	0.811	regulation of cellular response to stress
GO:0009893	0.794	positive regulation of metabolic process
GO:1900744	0.724	regulation of p38MAPK cascade
GO:0065009	0.686	regulation of molecular function
GO:0032874	0.674	positive regulation of stress-activated MAPK cascade
GO:0010605	0.663	negative regulation of macromolecule metabolic process
GO:0051716	0.649	cellular response to stimulus
GO:0051172	0.575	negative regulation of nitrogen compound metabolic process
GO:0050790	0.572	regulation of catalytic activity
GO:0051246	0.545	regulation of protein metabolic process
GO:0031324	0.528	negative regulation of cellular metabolic process
GO:0032502	0.516	developmental process
GO:0048856	0.514	anatomical structure development
GO:0010468	0.507	regulation of gene expression
GO:0051174	0.501	regulation of phosphorus metabolic process
GO:0046328	0.489	regulation of JNK cascade
GO:0010604	0.476	positive regulation of macromolecule metabolic process
GO:0008152	0.451	metabolic process
GO:0032501	0.420	multicellular organismal process
GO:0006950	0.410	response to stress
GO:0051338	0.410	regulation of transferase activity
GO:0051173	0.398	positive regulation of nitrogen compound metabolic process
GO:0009889	0.386	regulation of biosynthetic process
GO:0031325	0.382	positive regulation of cellular metabolic process
GO:0042325	0.362	regulation of phosphorylation
GO:0010556	0.356	regulation of macromolecule biosynthetic process
GO:0031399	0.351	regulation of protein modification process
GO:0031326	0.344	regulation of cellular biosynthetic process
GO:0019219	0.332	regulation of nucleobase-containing compound metabolic process
GO:0046330	0.329	positive regulation of JNK cascade
GO:0051726	0.328	regulation of cell cycle
GO:0071704	0.322	organic substance metabolic process
GO:0051252	0.318	regulation of RNA metabolic process
GO:0044237	0.312	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.992	cytoplasm
GO:0005829	0.448	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]