StarFunc result for job id O95259

User Input

>input (989 residues)
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLR
LGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY
QLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFA
VAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNVLTEHASANH
SLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARF
KDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDNVGEARSP
QDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTS
RRSSQSPQELFEISRPQSPESERDIFGAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IEI6	0.776	0.803	0.000	956	0.789	0.816	A0A0R4IEI6.pdb.gz
2	AFDB:B3DHL9	0.739	0.761	0.000	959	0.798	0.823	B3DHL9.pdb.gz
3	AFDB:O95259	1.000	1.000	0.000	989	1.000	1.000	O95259.pdb.gz	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
4	AFDB:Q63472	0.806	0.828	0.000	962	0.950	0.977	Q63472.pdb.gz	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
5	AFDB:Q8NCM2	0.753	0.754	0.000	988	0.733	0.734	Q8NCM2.pdb.gz	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
6	AFDB:O44164	0.680	0.704	1.707E-87	956	0.449	0.464	O44164.pdb.gz	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
7	AFDB:O54853	0.597	0.621	4.906E-68	950	0.336	0.349	O54853.pdb.gz	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
8	AFDB:Q9H252	0.601	0.598	8.911E-68	994	0.330	0.328	Q9H252.pdb.gz	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
9	AFDB:Q9NS40	0.578	0.484	1.851E-66	1196	0.337	0.278	Q9NS40.pdb.gz	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
10	AFDB:B3DJX4	0.608	0.511	2.494E-66	1186	0.336	0.280	B3DJX4.pdb.gz
11	PDB:7wswA	0.355	0.689	1.736E-24	472	0.105	0.220	7wswA.pdb.gz
12	PDB:7rhsA	0.390	0.802	1.918E-24	456	0.110	0.239	7rhsA.pdb.gz
13	PDB:7n15A	0.373	0.666	3.106E-23	520	0.108	0.206	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
14	PDB:7rhsD	0.363	0.754	5.031E-22	441	0.093	0.209	7rhsD.pdb.gz
15	PDB:7calA	0.380	0.801	2.596E-21	444	0.099	0.221	7calA.pdb.gz
16	PDB:7xufA	0.354	0.667	4.062E-21	476	0.114	0.237	7xufA.pdb.gz
17	PDB:7o4hB	0.380	0.751	2.647E-19	468	0.107	0.226	7o4hB.pdb.gz
18	PDB:7o4hD	0.255	0.605	5.830E-12	383	0.066	0.170	7o4hD.pdb.gz
19	PDB:2wkpA	0.112	0.338	1.175E-8	320	0.032	0.100	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
20	PDB:6eo1A	0.126	0.281	2.876E-8	355	0.072	0.200	6eo1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S1TJ81	0.0	721	454	0.354	0.771	A0A0S1TJ81_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
2	A0A1W2PPA2	0.0	1045	605	0.518	0.846	A0A1W2PPA2_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
3	K4EHU2	0.0	1592	956	0.789	0.816	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
4	O18965	0.0	1999	987	0.969	0.971	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
5	O44164	0.0	868	956	0.431	0.446	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
6	O54853	0.0	565	950	0.300	0.313	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
7	O95259	0.0	2062	989	1.000	1.000	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
8	Q02280	0.0	993	1174	0.485	0.409	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
9	Q108P3	0.0	1570	959	0.797	0.822	Q108P3_DANRE Potassium voltage-gated channel subfamily H member 1 OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
10	Q60603	0.0	2002	989	0.972	0.972	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
11	Q63472	0.0	1946	962	0.950	0.977	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
12	Q8NCM2	0.0	1491	988	0.741	0.742	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
13	Q9EPI9	0.0	1481	988	0.735	0.736	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
14	Q9H252	0.0	558	994	0.300	0.299	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
15	Q96L42	4.29e-164	513	1107	0.290	0.259	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
16	Q9QWS8	3.13e-163	510	1102	0.290	0.260	KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus OX=10116 GN=Kcnh8 PE=2 SV=2
17	A8WHX9	1.84e-158	492	914	0.298	0.323	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
18	Q9ULD8	1.00e-157	495	1083	0.290	0.265	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
19	Q9UQ05	9.72e-157	491	1017	0.288	0.280	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
20	O54852	3.82e-151	481	1195	0.247	0.204	KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus OX=10116 GN=Kcnh7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	1.6e-10	52.2	Cyclic nucleotide-binding domain
2	PF07883 Cupin_2	1e+02	14.0	Cupin domain
3	PF05899 Cupin_3	2.2e+02	12.9	EutQ-like cupin domain
4	PF00520 Ion_trans	3e-34	129.9	Ion transport protein
5	PF07885 Ion_trans_2	7.3e-09	46.8	Ion channel
6	PF05531 NPV_P10	5.2e+02	12.5	Nucleopolyhedrovirus P10 protein
7	PF00989 PAS	0.0027	29.1	PAS fold
8	PF08447 PAS_3	0.086	24.5	PAS fold
9	PF08448 PAS_4	40	15.9	PAS fold
10	PF13426 PAS_9	1e-13	62.8	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271751

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000291295	0.924	Calmodulin 3 (phosphorylase kinase, delta)
2	9606.ENSP00000419952	0.897	Voltage-gated potassium channel subunit beta-1
3	9606.ENSP00000360806	0.884	Potassium voltage-gated channel subfamily B member 1
4	9606.ENSP00000265969	0.883	Potassium voltage-gated channel subfamily C member 1
5	9606.ENSP00000367323	0.875	Voltage-gated potassium channel subunit beta-2
6	9606.ENSP00000433109	0.860	Potassium voltage-gated channel subfamily A member 2
7	9606.ENSP00000302719	0.856	Voltage-gated potassium channel subunit beta-3
8	9606.ENSP00000371985	0.852	Potassium voltage-gated channel subfamily A member 1
9	9606.ENSP00000352035	0.845	Potassium voltage-gated channel subfamily KQT member 2
10	9606.ENSP00000328511	0.840	Potassium voltage-gated channel subfamily A member 4
11	9606.ENSP00000358784	0.836	Potassium voltage-gated channel subfamily A member 3
12	9606.ENSP00000373648	0.832	Potassium voltage-gated channel subfamily KQT member 3
13	9606.ENSP00000333496	0.829	Potassium voltage-gated channel subfamily D member 2
14	9606.ENSP00000319591	0.822	Potassium voltage-gated channel subfamily D member 3
15	9606.ENSP00000252321	0.813	Potassium voltage-gated channel subfamily A member 5
16	9606.ENSP00000355964	0.812	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1
17	9606.ENSP00000155840	0.810	Potassium voltage-gated channel subfamily KQT member 1
18	9606.ENSP00000349467	0.798	Calmodulin-1
19	9606.ENSP00000358802	0.795	Potassium voltage-gated channel subfamily C member 4
20	9606.ENSP00000218176	0.789	Potassium voltage-gated channel subfamily D member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005249	0.999	voltage-gated potassium channel activity
GO:0005515	0.995	protein binding
GO:0005251	0.903	delayed rectifier potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.995	transport
GO:0030001	0.993	metal ion transport
GO:0009987	0.988	cellular process
GO:0006813	0.984	potassium ion transport
GO:0098660	0.961	inorganic ion transmembrane transport
GO:0098662	0.942	inorganic cation transmembrane transport
GO:0071805	0.915	potassium ion transmembrane transport
GO:0065007	0.604	biological regulation
GO:0050789	0.554	regulation of biological process
GO:0050794	0.530	regulation of cellular process
GO:0032501	0.310	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.951	protein-containing complex
GO:0034702	0.879	ion channel complex
GO:0034703	0.844	cation channel complex
GO:0034705	0.823	potassium channel complex
GO:0008076	0.680	voltage-gated potassium channel complex
GO:0043227	0.441	membrane-bounded organelle
GO:0043229	0.410	intracellular organelle
GO:0043231	0.376	intracellular membrane-bounded organelle
GO:0005737	0.336	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.999	K(+)(in) = K(+)(out)

[back to server]