StarFunc result for job id O95267

User Input

>input (797 residues)
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI
SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQGDCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0YKM0	0.759	0.715	1.844E-102	848	0.989	0.929	H0YKM0.pdb.gz	H0YKM0_HUMAN RAS guanyl releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1
2	AFDB:Q9R1K8	0.842	0.844	2.577E-97	795	0.898	0.901	Q9R1K8.pdb.gz	GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus OX=10116 GN=Rasgrp1 PE=1 SV=1
3	AFDB:Q1L9A0	0.656	0.757	6.042E-58	687	0.448	0.520	Q1L9A0.pdb.gz	Q1L9A0_DANRE RAS guanyl-releasing protein 1 OS=Danio rerio OX=7955 GN=si:dkey-12o15.1 PE=2 SV=1
4	AFDB:Q69ZX7	0.597	0.679	4.318E-54	693	0.450	0.518	Q69ZX7.pdb.gz	Q69ZX7_MOUSE MKIAA0846 protein (Fragment) OS=Mus musculus OX=10090 GN=Rasgrp3 PE=2 SV=1
5	AFDB:Q8TDF6	0.630	0.741	3.668E-51	673	0.376	0.446	Q8TDF6.pdb.gz	GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens OX=9606 GN=RASGRP4 PE=1 SV=2
6	AFDB:Q8IS19	0.397	0.469	1.059E-14	668	0.100	0.120	Q8IS19.pdb.gz	GEFD_DICDI Ras guanine nucleotide exchange factor D OS=Dictyostelium discoideum OX=44689 GN=gefD PE=2 SV=1
7	AFDB:P26674	0.396	0.349	2.688E-14	911	0.103	0.090	P26674.pdb.gz	STE6_SCHPO Protein ste6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ste6 PE=4 SV=1
8	AFDB:P26675	0.404	0.210	5.467E-14	1596	0.156	0.078	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
9	AFDB:Q07889	0.412	0.255	7.135E-14	1333	0.167	0.100	Q07889.pdb.gz	SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1
10	AFDB:F1MAI3	0.377	0.232	2.262E-13	1333	0.151	0.090	F1MAI3.pdb.gz	F1MAI3_RAT SOS Ras/Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Sos2 PE=4 SV=1
11	PDB:4f7zA	0.384	0.326	4.032E-10	946	0.087	0.073	4f7zA.pdb.gz
12	PDB:2byvE	0.366	0.320	7.505E-10	922	0.088	0.076	2byvE.pdb.gz
13	PDB:1xa6A	0.067	0.131	3.989E-3	399	0.044	0.088	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	PDB:3cxlA	0.067	0.132	1.059E-2	402	0.038	0.075	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
15	PDB:3pfqA	0.053	0.081	7.797E-2	523	0.028	0.042	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
16	PDB:7xw5R	0.059	0.074	1.517E-1	572	0.048	0.066	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.
17	PDB:3gniA	0.086	0.128	1.812E-1	335	0.064	0.152	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
18	PDB:4c0qB	0.090	0.095	2.701E-1	749	0.094	0.100	4c0qB.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
19	PDB:7qfwA	0.100	0.099	3.372E-1	823	0.063	0.061	7qfwA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
20	PDB:7tzcA	0.086	0.029	3.525E-1	4404	0.082	0.015	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YKM0	0.0	1641	848	0.986	0.927	H0YKM0_HUMAN RAS guanyl releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1
2	O95267	0.0	1665	797	1.000	1.000	GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2
3	Q1L9A0	0.0	658	687	0.444	0.515	Q1L9A0_DANRE RAS guanyl-releasing protein 1 OS=Danio rerio OX=7955 GN=si:dkey-12o15.1 PE=2 SV=1
4	Q2PHE9	0.0	697	691	0.450	0.520	Q2PHE9_MOUSE RasGRP3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=2 SV=1
5	Q69ZX7	0.0	699	693	0.455	0.524	Q69ZX7_MOUSE MKIAA0846 protein (Fragment) OS=Mus musculus OX=10090 GN=Rasgrp3 PE=2 SV=1
6	Q6NZH9	0.0	698	691	0.450	0.520	Q6NZH9_MOUSE RAS, guanyl releasing protein 3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=1 SV=1
7	Q8IV61	0.0	702	690	0.455	0.526	GRP3_HUMAN Ras guanyl-releasing protein 3 OS=Homo sapiens OX=9606 GN=RASGRP3 PE=1 SV=1
8	Q8TDF6	0.0	543	673	0.358	0.423	GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens OX=9606 GN=RASGRP4 PE=1 SV=2
9	Q9R1K8	0.0	1489	795	0.898	0.901	GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus OX=10116 GN=Rasgrp1 PE=1 SV=1
10	Q9Z1S3	0.0	1492	795	0.903	0.906	GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus OX=10090 GN=Rasgrp1 PE=1 SV=1
11	Q7LDG7	2.00e-177	525	609	0.321	0.420	GRP2_HUMAN RAS guanyl-releasing protein 2 OS=Homo sapiens OX=9606 GN=RASGRP2 PE=1 SV=1
12	Q9QUG9	7.16e-177	523	608	0.321	0.421	GRP2_MOUSE RAS guanyl-releasing protein 2 OS=Mus musculus OX=10090 GN=Rasgrp2 PE=1 SV=2
13	C0LTP6	4.98e-172	511	617	0.338	0.436	C0LTP6_HUMAN RAS guanyl releasing protein 4 OS=Homo sapiens OX=9606 GN=RASGRP4 PE=1 SV=1
14	Q19770	1.15e-121	382	654	0.245	0.298	Q19770_CAEEL Ras guanyl-releasing protein 3 OS=Caenorhabditis elegans OX=6239 GN=rgef-1 PE=3 SV=3
15	Q13905	2.78e-22	105	1077	0.112	0.083	RPGF1_HUMAN Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1 PE=1 SV=3
16	A0A8I5ZRV1	4.92e-22	104	1112	0.110	0.079	A0A8I5ZRV1_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
17	A0A8I5ZUL6	5.11e-22	104	1074	0.108	0.080	A0A8I5ZUL6_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
18	A0A8I6A6H6	5.72e-22	104	1221	0.110	0.072	A0A8I6A6H6_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
19	A0A8I5ZQV4	5.83e-22	104	1123	0.110	0.078	A0A8I5ZQV4_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
20	A0A5F8MPI9	1.58e-21	102	1087	0.109	0.080	A0A5F8MPI9_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	8e+02	11.6	bZIP transcription factor
2	PF00130 C1_1	4.6e-11	53.7	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF14197 Cep57_CLD_2	6.5e+02	11.8	Centrosome localisation domain of PPC89
4	PF00036 EF-hand_1	0.00053	30.4	EF hand
5	PF13202 EF-hand_5	0.1	23.3	EF hand
6	PF13405 EF-hand_6	2.7e-05	34.6	EF-hand domain
7	PF13499 EF-hand_7	0.00097	30.9	EF-hand domain pair
8	PF13833 EF-hand_8	7.6	17.7	EF-hand domain pair
9	PF00617 RasGEF	8e-41	151.7	RasGEF domain
10	PF00618 RasGEF_N	0.00094	30.8	RasGEF N-terminal motif
11	PF10591 SPARC_Ca_bdg	4.6e+02	12.6	Secreted protein acidic and rich in cysteine Ca binding region
12	PF06005 ZapB	1.8e+02	14.0	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407586	0.970	GTPase HRas
2	9606.ENSP00000256078	0.966	GTPase KRas
3	9606.ENSP00000250559	0.963	Ras-related protein Rap-1b
4	9606.ENSP00000244007	0.953	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
5	9606.ENSP00000358548	0.953	GTPase NRas
6	9606.ENSP00000358723	0.951	Ras-related protein Rap-1A
7	9606.ENSP00000246792	0.945	Ras-related protein R-Ras
8	9606.ENSP00000338171	0.940	Src kinase-associated phosphoprotein 1
9	9606.ENSP00000263125	0.925	Protein kinase C theta type
10	9606.ENSP00000412178	0.872	Diacylglycerol kinase zeta
11	9606.ENSP00000387784	0.854	Son of sevenless homolog 1
12	9606.ENSP00000216373	0.849	Son of sevenless homolog 2
13	9606.ENSP00000338864	0.816	RAS guanyl-releasing protein 2
14	9606.ENSP00000256196	0.813	Ras-related protein R-Ras2
15	9606.ENSP00000306253	0.747	Inositol 1,4,5-trisphosphate receptor type 1
16	9606.ENSP00000363435	0.747	Inositol 1,4,5-trisphosphate receptor type 3
17	9606.ENSP00000376345	0.739	Growth factor receptor-bound protein 2
18	9606.ENSP00000046794	0.720	Lymphocyte cytosolic protein 2
19	9606.ENSP00000376297	0.714	Dynein light chain 1, cytoplasmic
20	9606.ENSP00000289104	0.705	Ras-related protein M-Ras

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.997	protein binding
GO:0043167	0.709	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048583	0.983	regulation of response to stimulus
GO:0023051	0.983	regulation of signaling
GO:0010646	0.983	regulation of cell communication
GO:0023052	0.978	signaling
GO:0007154	0.978	cell communication
GO:0048522	0.977	positive regulation of cellular process
GO:0045321	0.977	leukocyte activation
GO:0051716	0.976	cellular response to stimulus
GO:1902531	0.968	regulation of intracellular signal transduction
GO:0065009	0.965	regulation of molecular function
GO:0002684	0.963	positive regulation of immune system process
GO:0035556	0.962	intracellular signal transduction
GO:0043085	0.957	positive regulation of catalytic activity
GO:0051239	0.953	regulation of multicellular organismal process
GO:0051345	0.949	positive regulation of hydrolase activity
GO:0007264	0.948	small GTPase mediated signal transduction
GO:0051240	0.913	positive regulation of multicellular organismal process
GO:0051347	0.881	positive regulation of transferase activity
GO:0043547	0.879	positive regulation of GTPase activity
GO:0033674	0.848	positive regulation of kinase activity
GO:0050865	0.847	regulation of cell activation
GO:0001934	0.839	positive regulation of protein phosphorylation
GO:0051179	0.835	localization
GO:0070374	0.835	positive regulation of ERK1 and ERK2 cascade
GO:0050778	0.825	positive regulation of immune response
GO:0002833	0.811	positive regulation of response to biotic stimulus
GO:0045860	0.799	positive regulation of protein kinase activity
GO:0043405	0.786	regulation of MAP kinase activity
GO:0042110	0.783	T cell activation
GO:0070302	0.780	regulation of stress-activated protein kinase signaling cascade
GO:0090630	0.778	activation of GTPase activity
GO:0071902	0.755	positive regulation of protein serine/threonine kinase activity
GO:0001819	0.740	positive regulation of cytokine production
GO:0051056	0.725	regulation of small GTPase mediated signal transduction
GO:0002252	0.704	immune effector process
GO:0002708	0.657	positive regulation of lymphocyte mediated immunity
GO:0051057	0.634	positive regulation of small GTPase mediated signal transduction
GO:0051234	0.619	establishment of localization
GO:0002366	0.607	leukocyte activation involved in immune response
GO:0031349	0.589	positive regulation of defense response
GO:0032101	0.587	regulation of response to external stimulus
GO:0046579	0.574	positive regulation of Ras protein signal transduction
GO:0032103	0.572	positive regulation of response to external stimulus
GO:0008283	0.565	cell population proliferation
GO:0032872	0.564	regulation of stress-activated MAPK cascade
GO:0007265	0.528	Ras protein signal transduction
GO:0048856	0.356	anatomical structure development
GO:0006810	0.336	transport
GO:0007166	0.335	cell surface receptor signaling pathway
GO:0048519	0.305	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0043226	0.964	organelle
GO:0043227	0.936	membrane-bounded organelle
GO:0012505	0.922	endomembrane system
GO:0043231	0.922	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]