StarFunc result for job id O95271

User Input

>input (1327 residues)
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPR
HGLALPEGDGSRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNP
AGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGA
NVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIV
LLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNV
NCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTEL
LLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPEL
RERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQV
TELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAAL
AGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKA
GDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVP
LHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKN
RDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTP
LHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATD
KWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEA
LPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERK
EGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLI
KGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGG
IFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER
HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSF
LQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTA
TAAEQKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95271	1.000	1.000	0.000	1327	1.000	1.000	O95271.pdb.gz	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
2	AFDB:Q3UES3	0.349	0.397	0.000	1166	0.713	0.811	Q3UES3.pdb.gz	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
3	AFDB:Q0KIE7	0.210	0.188	5.155E-36	1549	0.187	0.160	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
4	PDB:8cs9A	0.205	0.299	3.031E-35	796	0.185	0.309	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
5	PDB:5vkqA	0.172	0.158	9.794E-25	1499	0.155	0.137	5vkqA.pdb.gz
6	AFDB:A1DRY3	0.097	0.160	4.470E-15	782	0.098	0.166	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
7	AFDB:Q9H9B1	0.099	0.101	4.897E-12	1298	0.078	0.079	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
8	AFDB:A0A0G2K889	0.099	0.101	7.945E-12	1289	0.072	0.074	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
9	AFDB:A2ABF9	0.101	0.104	1.942E-11	1267	0.079	0.083	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
10	AFDB:A8TT22	0.104	0.114	1.942E-11	1173	0.082	0.093	A8TT22.pdb.gz	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
11	AFDB:Q8WZ74	0.087	0.072	2.924E-11	1663	0.143	0.114	Q8WZ74.pdb.gz	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
12	AFDB:A2ABF8	0.104	0.110	3.270E-11	1233	0.078	0.084	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
13	PDB:4oauC	0.095	0.179	1.142E-10	692	0.100	0.192	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.092	0.504	3.005E-10	229	0.054	0.314	2dvwA.pdb.gz
15	PDB:1wg0A	0.096	0.492	5.483E-9	243	0.053	0.288	1wg0A.pdb.gz
16	PDB:6aunA	0.109	0.194	2.928E-8	618	0.055	0.118	6aunA.pdb.gz
17	PDB:6v9hC	0.114	0.451	3.039E-8	270	0.063	0.307	6v9hC.pdb.gz
18	PDB:6mwqA	0.112	0.289	4.116E-7	493	0.081	0.217	6mwqA.pdb.gz
19	PDB:6jd6B	0.112	0.729	3.843E-6	192	0.038	0.260	6jd6B.pdb.gz
20	PDB:6pqpA	0.109	0.216	4.460E-6	615	0.072	0.154	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IYN3	0.0	2191	1274	0.801	0.834	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1
2	A0A8I5YBL7	0.0	2615	1313	0.965	0.975	A0A8I5YBL7_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1
3	A3KGU1	0.0	2195	1267	0.801	0.839	A3KGU1_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=LOC567533 PE=2 SV=1
4	D3Z8Q6	0.0	2646	1317	0.972	0.979	D3Z8Q6_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1
5	E7EWY6	0.0	1186	617	0.439	0.945	E7EWY6_HUMAN Tankyrase OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=1
6	O95271	0.0	2733	1327	1.000	1.000	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
7	Q3UES3	0.0	1961	1166	0.706	0.804	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
8	Q6PFX9	0.0	2636	1320	0.972	0.977	TNKS1_MOUSE Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1
9	Q9H2K2	0.0	1956	1166	0.708	0.806	TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1
10	Q9VBP3	0.0	1534	1181	0.576	0.648	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
11	A0A5F9ZHQ3	7.71e-85	308	1838	0.198	0.143	A0A5F9ZHQ3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZHN0	8.52e-85	308	1777	0.198	0.148	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHF7	1.43e-84	308	3862	0.198	0.068	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZHE2	1.52e-83	304	1806	0.201	0.148	A0A5F9ZHE2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZH17	1.68e-83	304	1879	0.201	0.142	A0A5F9ZH17_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZHL3	2.88e-83	303	1858	0.200	0.143	A0A5F9ZHL3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZH03	3.00e-83	303	1785	0.200	0.148	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZI08	3.18e-83	303	1797	0.200	0.147	A0A5F9ZI08_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZI36	3.31e-83	303	1846	0.200	0.144	A0A5F9ZI36_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHT8	4.51e-83	303	3891	0.201	0.069	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.2e-103	346.0	Ankyrin repeat
2	PF12796 Ank_2	4.2e-108	365.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.5e-86	283.2	Ankyrin repeat
4	PF13637 Ank_4	4.1e-102	344.6	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.7e-103	347.5	Ankyrin repeats (many copies)
6	PF08131 Defensin_3	3.7e+02	12.7	Defensin-like peptide family
7	PF00644 PARP	1.2e-22	92.0	Poly(ADP-ribose) polymerase catalytic domain
8	PF00536 SAM_1	9.5e-09	46.9	SAM domain (Sterile alpha motif)
9	PF07647 SAM_2	4.4e-11	54.0	SAM domain (Sterile alpha motif)
10	PF10366 Vps39_1	1.3e+02	14.3	Vacuolar sorting protein 39 domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311579

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276603	0.999	Telomeric repeat-binding factor 1
2	9606.ENSP00000262320	0.998	Axin-1
3	9606.ENSP00000357297	0.997	E3 ubiquitin-protein ligase RNF146
4	9606.ENSP00000231368	0.988	Leucyl-cystinyl aminopeptidase
5	9606.ENSP00000361021	0.978	Phosphatase and tensin homolog
6	9606.ENSP00000377298	0.963	Nuclear mitotic apparatus protein 1
7	9606.ENSP00000302625	0.962	Axin-2
8	9606.ENSP00000437271	0.959	182 kDa tankyrase-1-binding protein
9	9606.ENSP00000309572	0.944	Telomerase reverse transcriptase
10	9606.ENSP00000352257	0.935	X-ray repair cross-complementing protein 6
11	9606.ENSP00000375978	0.933	X-ray repair cross-complementing protein 5
12	9606.ENSP00000381577	0.932	Ubiquitin carboxyl-terminal hydrolase 34
13	9606.ENSP00000267415	0.930	TERF1-interacting nuclear factor 2
14	9606.ENSP00000262715	0.927	Telomerase protein component 1
15	9606.ENSP00000360689	0.921	Tankyrase-2
16	9606.ENSP00000272317	0.910	Ubiquitin-40S ribosomal protein S27a
17	9606.ENSP00000304697	0.910	Polyubiquitin-B
18	9606.ENSP00000441543	0.910	Polyubiquitin-C
19	9606.ENSP00000352408	0.907	BRISC and BRCA1-A complex member 1
20	9606.ENSP00000388107	0.907	Ubiquitin-60S ribosomal protein L40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003950	1.000	NAD+ ADP-ribosyltransferase activity
GO:1990404	0.996	NAD+-protein ADP-ribosyltransferase activity
GO:0008270	0.937	zinc ion binding
GO:0042393	0.932	histone binding
GO:0019899	0.802	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.988	response to stimulus
GO:0051716	0.969	cellular response to stimulus
GO:0050789	0.919	regulation of biological process
GO:0050794	0.913	regulation of cellular process
GO:0008152	0.900	metabolic process
GO:0007154	0.893	cell communication
GO:0071704	0.883	organic substance metabolic process
GO:0044238	0.881	primary metabolic process
GO:0006807	0.857	nitrogen compound metabolic process
GO:0043170	0.855	macromolecule metabolic process
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0048518	0.843	positive regulation of biological process
GO:0080090	0.841	regulation of primary metabolic process
GO:0051171	0.825	regulation of nitrogen compound metabolic process
GO:0048522	0.824	positive regulation of cellular process
GO:0031323	0.824	regulation of cellular metabolic process
GO:0048519	0.819	negative regulation of biological process
GO:0042221	0.799	response to chemical
GO:0044237	0.791	cellular metabolic process
GO:0009991	0.769	response to extracellular stimulus
GO:0048523	0.757	negative regulation of cellular process
GO:0009893	0.705	positive regulation of metabolic process
GO:0019219	0.702	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.691	positive regulation of nitrogen compound metabolic process
GO:0070887	0.688	cellular response to chemical stimulus
GO:0010604	0.688	positive regulation of macromolecule metabolic process
GO:0007584	0.672	response to nutrient
GO:0031325	0.671	positive regulation of cellular metabolic process
GO:0071840	0.659	cellular component organization or biogenesis
GO:0031326	0.659	regulation of cellular biosynthetic process
GO:0031670	0.654	cellular response to nutrient
GO:0010556	0.651	regulation of macromolecule biosynthetic process
GO:0016043	0.647	cellular component organization
GO:0043412	0.645	macromolecule modification
GO:0048583	0.644	regulation of response to stimulus
GO:0019538	0.635	protein metabolic process
GO:0010605	0.631	negative regulation of macromolecule metabolic process
GO:0051172	0.625	negative regulation of nitrogen compound metabolic process
GO:0031324	0.617	negative regulation of cellular metabolic process
GO:0036211	0.601	protein modification process
GO:0065009	0.567	regulation of molecular function
GO:0010468	0.541	regulation of gene expression
GO:0006996	0.508	organelle organization
GO:0045935	0.487	positive regulation of nucleobase-containing compound metabolic process
GO:0051179	0.473	localization
GO:0051128	0.458	regulation of cellular component organization
GO:0009966	0.452	regulation of signal transduction
GO:0006355	0.416	regulation of DNA-templated transcription
GO:0045934	0.375	negative regulation of nucleobase-containing compound metabolic process
GO:0048584	0.352	positive regulation of response to stimulus
GO:0044093	0.349	positive regulation of molecular function
GO:0010557	0.343	positive regulation of macromolecule biosynthetic process
GO:0031328	0.340	positive regulation of cellular biosynthetic process
GO:0050790	0.332	regulation of catalytic activity
GO:0051641	0.328	cellular localization
GO:0006950	0.321	response to stress
GO:0023052	0.305	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005654	0.977	nucleoplasm
GO:0016020	0.972	membrane
GO:0012505	0.969	endomembrane system
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0032991	0.851	protein-containing complex
GO:0005694	0.790	chromosome
GO:0031090	0.707	organelle membrane
GO:0140513	0.574	nuclear protein-containing complex
GO:0015630	0.470	microtubule cytoskeleton
GO:0016604	0.450	nuclear body
GO:0031967	0.445	organelle envelope
GO:0005813	0.430	centrosome
GO:0098687	0.420	chromosomal region
GO:0000781	0.381	chromosome, telomeric region
GO:0005635	0.361	nuclear envelope
GO:0005794	0.340	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	1.000	NAD(+) ADP-ribosyltransferase.

[back to server]