StarFunc result for job id O95292

User Input

>input (243 residues)
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI
IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLR
CVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV
QRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGK
IAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95292	1.000	1.000	1.224E-40	243	1.000	1.000	O95292.pdb.gz	VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3
2	AFDB:Q9QY76	0.696	0.696	7.140E-38	243	0.897	0.897	Q9QY76.pdb.gz	VAPB_MOUSE Vesicle-associated membrane protein-associated protein B OS=Mus musculus OX=10090 GN=Vapb PE=1 SV=3
3	AFDB:Q6P2B0	0.815	0.815	7.954E-33	243	0.749	0.749	Q6P2B0.pdb.gz	Q6P2B0_DANRE VAMP (vesicle-associated membrane protein)-associated protein B and C OS=Danio rerio OX=7955 GN=fc05d09 PE=1 SV=1
4	AFDB:Q9P0L0	0.668	0.654	4.908E-30	249	0.626	0.610	Q9P0L0.pdb.gz	VAPA_HUMAN Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3
5	AFDB:Q6P0D4	0.560	0.553	2.346E-29	246	0.593	0.585	Q6P0D4.pdb.gz
6	AFDB:Q9W4N8	0.498	0.451	9.752E-22	269	0.399	0.361	Q9W4N8.pdb.gz	Q9W4N8_DROME LD30122p OS=Drosophila melanogaster OX=7227 GN=Vap33 PE=1 SV=1
7	AFDB:O44782	0.500	0.496	1.347E-20	245	0.342	0.339	O44782.pdb.gz	O44782_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=vpr-1 PE=1 SV=1
8	AFDB:Q7KVX5	0.553	0.571	2.946E-20	235	0.395	0.409	Q7KVX5.pdb.gz	Q7KVX5_DROME VAMP-associated protein 33kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=Vap33 PE=1 SV=1
9	AFDB:Q10484	0.466	0.358	1.073E-15	319	0.239	0.182	Q10484.pdb.gz	SCS22_SCHPO Vesicle-associated membrane protein-associated protein scs22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=scs22 PE=1 SV=2
10	AFDB:O17099	0.485	0.319	2.482E-15	374	0.239	0.155	O17099.pdb.gz	O17099_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F42G2.5 PE=1 SV=1
11	PDB:2mspA	0.438	0.822	1.402E-9	124	0.099	0.194	2mspA.pdb.gz
12	PDB:1rowA	0.372	0.778	3.387E-8	107	0.095	0.215	1rowA.pdb.gz
13	PDB:4b0mM	0.382	0.433	6.465E-6	212	0.058	0.066	4b0mM.pdb.gz
14	PDB:5ghuA	0.372	0.444	1.413E-5	201	0.058	0.070	5ghuA.pdb.gz
15	PDB:7sqcO0	0.290	0.073	3.090E-5	1140	0.082	0.018	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:7b0xC	0.351	0.400	6.041E-5	211	0.070	0.081	7b0xC.pdb.gz
17	PDB:7sqcO1	0.308	0.127	6.388E-5	673	0.070	0.025	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:5dfkA	0.276	0.347	1.397E-4	185	0.058	0.076	5dfkA.pdb.gz
19	PDB:3zmrA	0.246	0.141	2.582E-4	469	0.045	0.023	3zmrA.pdb.gz	A Discrete Genetic Locus Confers Xyloglucan Metabolism in Select Human Gut Bacteroidetes
20	PDB:3sqbE	0.344	0.464	6.312E-4	176	0.053	0.074	3sqbE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95292	0.0	499	243	1.000	1.000	VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3
2	Q53XM7	0.0	499	243	1.000	1.000	Q53XM7_HUMAN VAMP (Vesicle-associated membrane protein)-associated protein B and C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=1
3	Q9QY76	3.55e-165	457	243	0.897	0.897	VAPB_MOUSE Vesicle-associated membrane protein-associated protein B OS=Mus musculus OX=10090 GN=Vapb PE=1 SV=3
4	Q6P2B0	3.53e-132	374	243	0.749	0.749	Q6P2B0_DANRE VAMP (vesicle-associated membrane protein)-associated protein B and C OS=Danio rerio OX=7955 GN=fc05d09 PE=1 SV=1
5	Q9P0L0	2.63e-106	309	249	0.634	0.618	VAPA_HUMAN Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3
6	A8KA83	4.86e-106	308	242	0.634	0.636	A8KA83_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
7	Q9WV55	1.84e-105	306	249	0.634	0.618	VAPA_MOUSE Vesicle-associated membrane protein-associated protein A OS=Mus musculus OX=10090 GN=Vapa PE=1 SV=2
8	Q9Z270	2.82e-105	306	249	0.630	0.614	VAPA_RAT Vesicle-associated membrane protein-associated protein A OS=Rattus norvegicus OX=10116 GN=Vapa PE=1 SV=3
9	Q7KVX5	1.03e-42	146	235	0.350	0.362	Q7KVX5_DROME VAMP-associated protein 33kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=Vap33 PE=1 SV=1
10	Q9W4N8	1.39e-42	147	269	0.358	0.323	Q9W4N8_DROME LD30122p OS=Drosophila melanogaster OX=7227 GN=Vap33 PE=1 SV=1
11	O44782	9.02e-40	139	245	0.383	0.380	O44782_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=vpr-1 PE=1 SV=1
12	O17099	3.52e-30	117	374	0.235	0.152	O17099_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F42G2.5 PE=1 SV=1
13	Q10484	7.44e-20	88.6	319	0.189	0.144	SCS22_SCHPO Vesicle-associated membrane protein-associated protein scs22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=scs22 PE=1 SV=2
14	O60119	1.17e-19	89.0	383	0.210	0.133	SCS2_SCHPO Vesicle-associated membrane protein-associated protein scs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=scs2 PE=1 SV=1
15	Q9VSD3	1.44e-16	77.8	218	0.218	0.243	Q9VSD3_DROME AT11025p OS=Drosophila melanogaster OX=7227 GN=fan PE=2 SV=3
16	Q9LVU1	2.49e-16	77.4	220	0.292	0.323	VAP21_ARATH Vesicle-associated protein 2-1 OS=Arabidopsis thaliana OX=3702 GN=PVA21 PE=1 SV=1
17	Q8VZ95	2.21e-13	69.7	256	0.235	0.223	VAP11_ARATH Vesicle-associated protein 1-1 OS=Arabidopsis thaliana OX=3702 GN=PVA11 PE=1 SV=1
18	Q9SHC8	3.45e-13	68.9	239	0.280	0.285	VAP12_ARATH Vesicle-associated protein 1-2 OS=Arabidopsis thaliana OX=3702 GN=PVA12 PE=1 SV=1
19	Q84WW5	1.45e-12	67.4	239	0.189	0.192	VAP13_ARATH Vesicle-associated protein 1-3 OS=Arabidopsis thaliana OX=3702 GN=PVA13 PE=2 SV=1
20	P40075	2.03e-12	67.0	244	0.148	0.148	SCS2_YEAST Vesicle-associated membrane protein-associated protein SCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCS2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04718 ATP-synt_G	5.7e+02	12.8	Mitochondrial ATP synthase g subunit
2	PF00170 bZIP_1	1.8e+02	13.6	bZIP transcription factor
3	PF07216 LcrG	2.4e+02	13.1	LcrG protein
4	PF00635 Motile_Sperm	3.7e-29	112.1	MSP (Major sperm protein) domain
5	PF06005 ZapB	20	17.0	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011386

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001043	0.908	StAR-related lipid transfer (START) domain containing 3
2	61853.ENSNLEP00000008487	0.867	VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
3	61853.ENSNLEP00000017679	0.836	Activating transcription factor 6
4	61853.ENSNLEP00000015864	0.826	Oxysterol binding protein
5	61853.ENSNLEP00000003934	0.755	Regulator of microtubule dynamics 3
6	61853.ENSNLEP00000004833	0.755	Oxysterol binding protein 2
7	61853.ENSNLEP00000010811	0.700	Uncharacterized protein
8	61853.ENSNLEP00000006304	0.698	Collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
9	61853.ENSNLEP00000023804	0.670	Uncharacterized protein
10	61853.ENSNLEP00000024205	0.670	Uncharacterized protein
11	61853.ENSNLEP00000000207	0.669	Phosphatidylinositol 4-kinase, catalytic, alpha
12	61853.ENSNLEP00000002145	0.668	Oxysterol binding protein-like 7
13	61853.ENSNLEP00000007417	0.668	Oxysterol binding protein-like 6
14	61853.ENSNLEP00000018124	0.668	Oxysterol binding protein-like 3
15	61853.ENSNLEP00000010427	0.663	RAB3 GTPase activating protein subunit 1 (catalytic)
16	61853.ENSNLEP00000019217	0.662	Oxysterol binding protein-like 2
17	61853.ENSNLEP00000005742	0.630	Valosin containing protein
18	61853.ENSNLEP00000019623	0.630	Oxysterol binding protein-like 9
19	61853.ENSNLEP00000007360	0.619	SAC1 suppressor of actin mutations 1-like (yeast)
20	61853.ENSNLEP00000017444	0.599	Alpha-synuclein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.986	regulation of biological process
GO:0016043	0.949	cellular component organization
GO:0051179	0.918	localization
GO:0006810	0.884	transport
GO:0051649	0.879	establishment of localization in cell
GO:0006996	0.838	organelle organization
GO:0050896	0.798	response to stimulus
GO:0046907	0.794	intracellular transport
GO:0050794	0.764	regulation of cellular process
GO:0044419	0.747	biological process involved in interspecies interaction between organisms
GO:0051716	0.738	cellular response to stimulus
GO:0016192	0.733	vesicle-mediated transport
GO:0051702	0.718	biological process involved in interaction with symbiont
GO:0061024	0.716	membrane organization
GO:0008152	0.648	metabolic process
GO:0048193	0.639	Golgi vesicle transport
GO:0048518	0.621	positive regulation of biological process
GO:0006950	0.616	response to stress
GO:0051851	0.571	modulation by host of symbiont process
GO:0044237	0.559	cellular metabolic process
GO:0016050	0.532	vesicle organization
GO:0032501	0.523	multicellular organismal process
GO:0008219	0.516	cell death
GO:0071704	0.511	organic substance metabolic process
GO:0042221	0.510	response to chemical
GO:0035891	0.462	exit from host cell
GO:0016032	0.459	viral process
GO:0044238	0.448	primary metabolic process
GO:0050792	0.440	regulation of viral process
GO:0019058	0.431	viral life cycle
GO:0010033	0.431	response to organic substance
GO:0044788	0.431	modulation by host of viral process
GO:0006900	0.429	vesicle budding from membrane
GO:0009605	0.408	response to external stimulus
GO:0042592	0.395	homeostatic process
GO:0007154	0.352	cell communication
GO:0019222	0.341	regulation of metabolic process
GO:0023052	0.340	signaling
GO:0048519	0.326	negative regulation of biological process
GO:0007165	0.303	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.997	endoplasmic reticulum
GO:0031090	0.996	organelle membrane
GO:0031984	0.978	organelle subcompartment
GO:0042175	0.973	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.958	endoplasmic reticulum membrane
GO:0005829	0.877	cytosol
GO:0005634	0.817	nucleus
GO:0043228	0.686	non-membrane-bounded organelle
GO:0043232	0.654	intracellular non-membrane-bounded organelle
GO:0071944	0.612	cell periphery
GO:0005794	0.529	Golgi apparatus
GO:0070013	0.511	intracellular organelle lumen
GO:0031981	0.501	nuclear lumen
GO:0005886	0.358	plasma membrane
GO:0031975	0.346	envelope
GO:0031967	0.344	organelle envelope
GO:0005654	0.330	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]