StarFunc result for job id O95297

User Input

>input (269 residues)
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKF
KSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASI
NIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLT
LLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVI
YAQLDHSGGHHSDKINKSESVVYADIRKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95297	1.000	1.000	4.737E-46	269	1.000	1.000	O95297.pdb.gz	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
2	AFDB:E7F7T2	0.554	0.563	5.122E-24	264	0.431	0.439	E7F7T2.pdb.gz	E7F7T2_DANRE Myelin protein zero-like 1 like OS=Danio rerio OX=7955 GN=zgc:110608 PE=1 SV=1
3	AFDB:P06907	0.521	0.562	1.874E-20	248	0.297	0.323	P06907.pdb.gz	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
4	AFDB:A0A2R8QN30	0.484	0.563	5.045E-19	228	0.257	0.303	A0A2R8QN30.pdb.gz	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
5	AFDB:A2BGB5	0.494	0.659	1.102E-18	199	0.268	0.362	A2BGB5.pdb.gz
6	AFDB:Q3V3F6	0.482	0.544	2.407E-18	237	0.227	0.257	Q3V3F6.pdb.gz	MPZL3_MOUSE Myelin protein zero-like protein 3 OS=Mus musculus OX=10090 GN=Mpzl3 PE=1 SV=3
7	AFDB:Q6UWV2	0.475	0.542	5.259E-18	235	0.227	0.260	Q6UWV2.pdb.gz	MPZL3_HUMAN Myelin protein zero-like protein 3 OS=Homo sapiens OX=9606 GN=MPZL3 PE=1 SV=1
8	AFDB:O60487	0.525	0.646	5.561E-18	215	0.219	0.274	O60487.pdb.gz	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
9	AFDB:O70255	0.523	0.645	4.147E-17	215	0.212	0.265	O70255.pdb.gz	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
10	AFDB:A4JYI5	0.477	0.534	1.013E-16	238	0.227	0.256	A4JYI5.pdb.gz
11	PDB:3oaiA	0.424	0.236	3.822E-15	488	0.204	0.113	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:5ir3A	0.354	0.791	1.952E-7	111	0.078	0.189	5ir3A.pdb.gz
13	PDB:1cd0A	0.357	0.805	7.049E-7	111	0.082	0.198	1cd0A.pdb.gz
14	PDB:3zhlA	0.347	0.695	9.318E-7	121	0.078	0.174	3zhlA.pdb.gz
15	PDB:1igaA	0.361	0.213	9.852E-7	475	0.078	0.044	1igaA.pdb.gz
16	PDB:1zvoC	0.342	0.190	9.852E-7	512	0.100	0.053	1zvoC.pdb.gz
17	PDB:4y5xB	0.350	0.784	1.628E-6	111	0.093	0.225	4y5xB.pdb.gz
18	PDB:6rulA	0.318	0.310	2.152E-6	276	0.059	0.058	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.
19	PDB:4pfeA	0.363	0.292	2.406E-6	342	0.067	0.053	4pfeA.pdb.gz
20	PDB:6hd8A	0.351	0.211	2.406E-6	461	0.067	0.039	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95297	0.0	555	269	1.000	1.000	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
2	E7F7T2	1.25e-67	212	264	0.431	0.439	E7F7T2_DANRE Myelin protein zero-like 1 like OS=Danio rerio OX=7955 GN=zgc:110608 PE=1 SV=1
3	P27573	6.22e-34	125	248	0.312	0.339	MYP0_MOUSE Myelin protein P0 OS=Mus musculus OX=10090 GN=Mpz PE=1 SV=1
4	P06907	1.05e-33	124	248	0.309	0.335	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
5	P25189	9.69e-33	122	248	0.301	0.327	MYP0_HUMAN Myelin protein P0 OS=Homo sapiens OX=9606 GN=MPZ PE=1 SV=1
6	Q8JG36	1.31e-30	115	199	0.253	0.342	Q8JG36_DANRE Epithelial V-like antigen 1 OS=Danio rerio OX=7955 GN=mpzl2 PE=1 SV=1
7	Q8JFG6	7.35e-27	105	203	0.190	0.251	Q8JFG6_DANRE Myelin protein P0 precursor OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
8	A0A2R8QN30	8.12e-27	105	228	0.190	0.224	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
9	A0A0R4IS04	1.21e-26	105	212	0.190	0.241	A0A0R4IS04_DANRE Myelin protein P0 isoform X2 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
10	O60487	4.23e-24	98.6	215	0.190	0.237	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
11	O70255	4.12e-21	90.5	215	0.212	0.265	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
12	Q6UWV2	1.58e-20	89.4	235	0.223	0.255	MPZL3_HUMAN Myelin protein zero-like protein 3 OS=Homo sapiens OX=9606 GN=MPZL3 PE=1 SV=1
13	Q3V3F6	6.24e-20	87.8	237	0.212	0.241	MPZL3_MOUSE Myelin protein zero-like protein 3 OS=Mus musculus OX=10090 GN=Mpzl3 PE=1 SV=3
14	Q56A07	7.63e-15	73.6	215	0.193	0.242	SCN2B_MOUSE Sodium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Scn2b PE=1 SV=1
15	P54900	8.78e-15	73.6	215	0.204	0.256	SCN2B_RAT Sodium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Scn2b PE=1 SV=1
16	O60939	1.87e-14	72.4	215	0.201	0.251	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
17	Q86XK7	1.20e-10	63.5	387	0.190	0.132	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
18	P97792	2.05e-10	62.8	365	0.171	0.126	CXAR_MOUSE Coxsackievirus and adenovirus receptor homolog OS=Mus musculus OX=10090 GN=Cxadr PE=1 SV=1
19	P78310	2.45e-10	62.4	365	0.156	0.115	CXAR_HUMAN Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1
20	Q6NW73	2.20e-09	58.2	215	0.123	0.153	Q6NW73_DANRE Myelin protein zero-like 3 OS=Danio rerio OX=7955 GN=zgc:85923 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02439 Adeno_E3_CR2	18	16.5	Adenovirus E3 region protein CR2
2	PF07679 I-set	1.1e+02	14.3	Immunoglobulin I-set domain
3	PF00047 ig	0.022	26.3	Immunoglobulin domain
4	PF13927 Ig_3	1.5	20.8	Immunoglobulin domain
5	PF09534 Trp_oprn_chp	33	15.7	Tryptophan-associated transmembrane protein (Trp_oprn_chp)
6	PF07686 V-set	2e-20	84.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000391592	0.869	Tyrosine-protein phosphatase non-receptor type 6
3	9606.ENSP00000432943	0.820	Myelin protein P0
4	9606.ENSP00000382941	0.764	Tyrosine-protein phosphatase non-receptor type substrate 1
5	9606.ENSP00000362680	0.699	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000367629	0.664	Rho guanine nucleotide exchange factor 16
7	9606.ENSP00000339186	0.630	GRB2-related adapter protein 2
8	9606.ENSP00000483486	0.607	ADP-ribosylation factor-related protein 1
9	9606.ENSP00000294129	0.595	NCK-interacting protein with SH3 domain
10	9606.ENSP00000337998	0.587	Nck-associated protein 5-like
11	9606.ENSP00000463325	0.586	Receptor-type tyrosine-protein phosphatase mu
12	9606.ENSP00000355133	0.580	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
13	9606.ENSP00000382507	0.580	UBX domain-containing protein 2B
14	9606.ENSP00000356820	0.515	Mitochondrial pyruvate carrier 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.994	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0050896	0.994	response to stimulus
GO:0007167	0.955	enzyme-linked receptor protein signaling pathway
GO:0007267	0.909	cell-cell signaling
GO:0007169	0.663	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048518	0.361	positive regulation of biological process
GO:0032501	0.341	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.975	cell junction
GO:0005622	0.779	intracellular anatomical structure
GO:0009986	0.759	cell surface
GO:0070161	0.733	anchoring junction
GO:0005737	0.687	cytoplasm
GO:0030055	0.641	cell-substrate junction
GO:0005925	0.577	focal adhesion
GO:0043226	0.531	organelle
GO:0005829	0.366	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]