StarFunc result for job id O95299

User Input

>input (355 residues)
MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVI
TVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDD
PRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIR
KQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENA
YKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQDNRTLYHLRLLVQD
KFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDKWIWLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7ESZ7	0.900	0.820	3.580E-53	390	0.997	0.908	E7ESZ7.pdb.gz	E7ESZ7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1
2	AFDB:Q561S0	0.929	0.929	2.225E-48	355	0.763	0.763	Q561S0.pdb.gz	NDUAA_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufa10 PE=1 SV=1
3	AFDB:P34942	0.912	0.943	3.092E-48	343	0.775	0.802	P34942.pdb.gz	NDUAA_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Bos taurus OX=9913 GN=NDUFA10 PE=1 SV=1
4	PDB:7qsdO	0.896	0.994	9.306E-42	320	0.727	0.806	7qsdO.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
5	PDB:5xtcw	0.857	0.948	1.878E-39	320	0.901	1.000	5xtcw.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
6	PDB:7ak5O	0.893	0.990	1.968E-39	320	0.699	0.775	7ak5O.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
7	AFDB:C9J6X0	0.571	0.823	5.059E-27	244	0.645	0.939	C9J6X0.pdb.gz	C9J6X0_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=8
8	AFDB:P91929	0.815	0.715	6.369E-23	407	0.349	0.305	P91929.pdb.gz	NDUAA_DROME NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ND-42 PE=1 SV=2
9	AFDB:Q54UT2	0.580	0.714	2.960E-10	285	0.200	0.249	Q54UT2.pdb.gz	DGK_DICDI Deoxyguanosine kinase OS=Dictyostelium discoideum OX=44689 GN=dgk PE=1 SV=2
10	AFDB:Q54YL2	0.492	0.697	1.001E-7	245	0.144	0.208	Q54YL2.pdb.gz	DAK_DICDI Deoxyadenosine kinase OS=Dictyostelium discoideum OX=44689 GN=dak PE=1 SV=1
11	AFDB:A0A0G2K478	0.494	0.620	6.869E-7	277	0.163	0.209	A0A0G2K478.pdb.gz	A0A0G2K478_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=4 SV=2
12	AFDB:Q9QX60	0.499	0.625	1.456E-6	277	0.161	0.206	Q9QX60.pdb.gz	DGUOK_MOUSE Deoxyguanosine kinase, mitochondrial OS=Mus musculus OX=10090 GN=Dguok PE=1 SV=3
13	AFDB:Q6GPW6	0.502	0.656	1.526E-6	265	0.130	0.174	Q6GPW6.pdb.gz	DGUOK_XENLA Deoxyguanosine kinase, mitochondrial OS=Xenopus laevis OX=8355 GN=dguok PE=1 SV=1
14	PDB:2no0A	0.502	0.715	3.490E-6	242	0.118	0.174	2no0A.pdb.gz	Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
15	PDB:2a2zB	0.470	0.726	6.133E-6	221	0.115	0.186	2a2zB.pdb.gz	Structural basis for the preference of UTP over ATP in human deoxycytidine kinase: illuminating the role of main-chain reorganization.
16	PDB:2vp4D	0.425	0.714	7.400E-6	199	0.124	0.221	2vp4D.pdb.gz	Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
17	PDB:4tmkA	0.408	0.639	2.889E-5	210	0.104	0.176	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.
18	PDB:2wwfC	0.426	0.663	3.830E-5	212	0.118	0.198	2wwfC.pdb.gz	Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
19	PDB:1e2fA	0.353	0.549	7.747E-5	210	0.110	0.186	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
20	PDB:2c95A	0.364	0.607	1.182E-4	195	0.099	0.179	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WXC5	0.0	732	371	1.000	0.957	A0A087WXC5_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=2
2	E7ESZ7	0.0	722	390	1.000	0.910	E7ESZ7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1
3	H7C1Y7	0.0	695	362	0.938	0.920	H7C1Y7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=2
4	H7C2X4	0.0	696	375	0.946	0.896	H7C2X4_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=2
5	O95299	0.0	742	355	1.000	1.000	NDUAA_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1
6	P34942	0.0	549	343	0.772	0.799	NDUAA_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Bos taurus OX=9913 GN=NDUFA10 PE=1 SV=1
7	Q561S0	0.0	586	355	0.763	0.763	NDUAA_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufa10 PE=1 SV=1
8	Q99LC3	0.0	587	355	0.766	0.766	NDUAA_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Mus musculus OX=10090 GN=Ndufa10 PE=1 SV=1
9	Q8N1B9	3.33e-134	382	201	0.515	0.910	Q8N1B9_HUMAN NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex, 10, 42kDa, isoform CRA_c OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1
10	C9J6X0	6.53e-133	380	244	0.535	0.779	C9J6X0_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=8
11	P91929	2.14e-56	191	407	0.335	0.292	NDUAA_DROME NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ND-42 PE=1 SV=2
12	Q54UT2	1.14e-22	98.2	285	0.175	0.218	DGK_DICDI Deoxyguanosine kinase OS=Dictyostelium discoideum OX=44689 GN=dgk PE=1 SV=2
13	Q54YL2	5.88e-07	52.4	245	0.146	0.212	DAK_DICDI Deoxyadenosine kinase OS=Dictyostelium discoideum OX=44689 GN=dak PE=1 SV=1
14	Q501D4	1.63e-04	45.8	580	0.158	0.097	Q501D4_ARATH At1g72040 OS=Arabidopsis thaliana OX=3702 GN=DNK PE=1 SV=1
15	Q16854	6.46e-04	43.5	277	0.132	0.170	DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens OX=9606 GN=DGUOK PE=1 SV=2
16	Q9QX60	8.77e-04	42.7	277	0.180	0.231	DGUOK_MOUSE Deoxyguanosine kinase, mitochondrial OS=Mus musculus OX=10090 GN=Dguok PE=1 SV=3
17	Q5ZJM7	0.001	42.7	265	0.138	0.185	DCK2_CHICK Deoxycytidine kinase 2 OS=Gallus gallus OX=9031 GN=DCK2 PE=1 SV=1
18	A0A8I5ZV32	0.002	42.0	309	0.144	0.165	A0A8I5ZV32_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=1 SV=1
19	D3ZDE4	0.003	41.2	278	0.144	0.183	D3ZDE4_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=3 SV=1
20	Q3KSQ2	0.085	37.4	607	0.054	0.031	KITH_EBVG Thymidine kinase OS=Epstein-Barr virus (strain GD1) OX=10376 GN=TK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	15	17.4	AAA domain
2	PF13238 AAA_18	97	14.9	AAA domain
3	PF02224 Cytidylate_kin	92	14.2	Cytidylate kinase
4	PF13189 Cytidylate_kin2	5.5e+02	12.1	Cytidylate kinase-like family
5	PF01712 dNK	6.7e-31	119.3	Deoxynucleoside kinase
6	PF01202 SKI	2.6e+02	13.1	Shikimate kinase
7	PF02223 Thymidylate_kin	3.9	18.6	Thymidylate kinase
8	PF02367 TsaE	3.6e+02	12.5	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252711

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000237889	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
5	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
11	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
12	9606.ENSP00000281031	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
13	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
14	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
15	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
16	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
17	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
18	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
19	9606.ENSP00000356972	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
20	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008137	0.998	NADH dehydrogenase (ubiquinone) activity
GO:0016740	0.874	transferase activity
GO:0005488	0.777	binding
GO:0005515	0.770	protein binding
GO:0019205	0.677	nucleobase-containing compound kinase activity
GO:0019206	0.366	nucleoside kinase activity
GO:0016776	0.339	phosphotransferase activity, phosphate group as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071840	0.928	cellular component organization or biogenesis
GO:0010257	0.907	NADH dehydrogenase complex assembly
GO:0007005	0.904	mitochondrion organization
GO:0044237	0.896	cellular metabolic process
GO:0032981	0.756	mitochondrial respiratory chain complex I assembly
GO:0015980	0.554	energy derivation by oxidation of organic compounds
GO:0009060	0.516	aerobic respiration
GO:0006119	0.425	oxidative phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.993	membrane
GO:0032991	0.989	protein-containing complex
GO:0031090	0.950	organelle membrane
GO:0005740	0.936	mitochondrial envelope
GO:0031966	0.933	mitochondrial membrane
GO:0098796	0.925	membrane protein complex
GO:0019866	0.923	organelle inner membrane
GO:1902494	0.921	catalytic complex
GO:1902495	0.911	transmembrane transporter complex
GO:1990204	0.901	oxidoreductase complex
GO:0098803	0.901	respiratory chain complex
GO:0005746	0.896	mitochondrial respirasome
GO:0098800	0.865	inner mitochondrial membrane protein complex
GO:0005747	0.857	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	0.998	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	0.998	NADH:ubiquinone reductase (H(+)-translocating).
EC:2.-.-.-	0.874	Transferases.
EC:2.7.-.-	0.677	Transferring phosphorus-containing groups.
EC:2.7.4.-	0.339	Phosphotransferases with a phosphate group as acceptor.

[back to server]