StarFunc result for job id O95319

User Input

>input (508 residues)
MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELF
EPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKP
ADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFS
TRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNL
TGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATST
NANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGM
AALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGP
EGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAA
IQAMNGFQIGMKRLKVQLKRSKNDSKPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EA30	0.563	0.556	1.316E-76	514	0.776	0.767	G5EA30.pdb.gz	G5EA30_HUMAN CUG triplet repeat, RNA binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=1
2	AFDB:Q9IBD0	0.467	0.472	2.051E-72	501	0.750	0.760	Q9IBD0.pdb.gz	CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio OX=7955 GN=celf1 PE=1 SV=1
3	AFDB:Q8IP90	0.357	0.234	4.340E-49	810	0.474	0.298	Q8IP90.pdb.gz	Q8IP90_DROME Bruno 1, isoform B OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
4	AFDB:Q8N6W0	0.338	0.352	7.996E-49	485	0.457	0.478	Q8N6W0.pdb.gz	CELF5_HUMAN CUGBP Elav-like family member 5 OS=Homo sapiens OX=9606 GN=CELF5 PE=1 SV=1
5	AFDB:F4I0X0	0.275	0.310	5.164E-40	438	0.293	0.340	F4I0X0.pdb.gz	F4I0X0_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=BRN2 PE=1 SV=1
6	AFDB:Q9VU91	0.199	0.235	2.371E-36	422	0.358	0.431	Q9VU91.pdb.gz	Q9VU91_DROME Bruno 3, isoform A OS=Drosophila melanogaster OX=7227 GN=bru3 PE=2 SV=2
7	AFDB:M9MS33	0.211	0.266	5.248E-36	396	0.350	0.449	M9MS33.pdb.gz	M9MS33_DROME Bruno 3, isoform C OS=Drosophila melanogaster OX=7227 GN=bru3 PE=4 SV=1
8	AFDB:M9MS39	0.181	0.248	1.441E-27	370	0.285	0.392	M9MS39.pdb.gz	M9MS39_DROME Bruno 3, isoform M OS=Drosophila melanogaster OX=7227 GN=bru3 PE=4 SV=1
9	AFDB:M9MRT9	0.217	0.307	8.475E-27	345	0.293	0.432	M9MRT9.pdb.gz	M9MRT9_DROME Bruno 3, isoform L OS=Drosophila melanogaster OX=7227 GN=bru3 PE=4 SV=1
10	AFDB:Q9VHC7	0.164	0.141	3.733E-22	632	0.203	0.163	Q9VHC7.pdb.gz	Q9VHC7_DROME FI21236p1 OS=Drosophila melanogaster OX=7227 GN=rump PE=1 SV=1
11	PDB:5vsuA	0.150	0.195	4.303E-12	387	0.106	0.140	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:7oqcF	0.152	0.281	5.841E-12	267	0.094	0.180	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:6r5kH	0.166	0.205	7.928E-12	394	0.165	0.213	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
14	PDB:6y53o	0.148	0.456	9.523E-12	160	0.104	0.331	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:5lsbA	0.163	0.413	1.343E-9	176	0.081	0.233	5lsbA.pdb.gz
16	PDB:7evoD	0.150	0.368	4.847E-9	200	0.071	0.180	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.154	0.410	6.189E-9	178	0.065	0.185	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6gd1A	0.156	0.408	4.114E-8	190	0.069	0.184	6gd1A.pdb.gz
19	PDB:6ff7X	0.133	0.338	5.253E-8	171	0.075	0.222	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:7dvqY	0.151	0.523	1.677E-7	140	0.051	0.186	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YXJ0	0.0	995	533	0.965	0.919	A0A0J9YXJ0_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=1
2	G5EA30	0.0	729	514	0.776	0.767	G5EA30_HUMAN CUG triplet repeat, RNA binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=1
3	O95319	0.0	1045	508	1.000	1.000	CELF2_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=1
4	P28659	0.0	724	486	0.760	0.794	CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus OX=10090 GN=Celf1 PE=1 SV=2
5	Q4QQT3	0.0	722	487	0.764	0.797	CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus OX=10116 GN=Celf1 PE=2 SV=1
6	Q5VZZ6	0.0	984	502	0.953	0.964	Q5VZZ6_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=2
7	Q792H5	0.0	1044	508	0.998	0.998	CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus OX=10116 GN=Celf2 PE=2 SV=1
8	Q7T2T1	0.0	986	484	0.943	0.990	CELF2_CHICK CUGBP Elav-like family member 2 OS=Gallus gallus OX=9031 GN=CELF2 PE=1 SV=2
9	Q92879	0.0	726	486	0.764	0.798	CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2
10	Q9IBD0	0.0	674	501	0.724	0.735	CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio OX=7955 GN=celf1 PE=1 SV=1
11	Q9Z0H4	0.0	1044	508	0.998	0.998	CELF2_MOUSE CUGBP Elav-like family member 2 OS=Mus musculus OX=10090 GN=Celf2 PE=1 SV=1
12	V9GYD9	0.0	862	440	0.858	0.991	V9GYD9_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens OX=9606 GN=CELF2 PE=1 SV=1
13	Q8IP89	2.22e-138	414	620	0.490	0.402	Q8IP89_DROME Bruno 1, isoform F OS=Drosophila melanogaster OX=7227 GN=bru1 PE=3 SV=2
14	M9PDB0	3.22e-138	412	573	0.480	0.426	M9PDB0_DROME Bruno 1, isoform H OS=Drosophila melanogaster OX=7227 GN=bru1 PE=3 SV=1
15	O02374	4.54e-138	413	604	0.480	0.404	O02374_DROME Bruno OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
16	Q960Z4	1.49e-137	412	604	0.480	0.404	Q960Z4_DROME Bruno 1, isoform A OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
17	O18409	1.13e-135	413	808	0.480	0.302	O18409_DROME Testis-specific RNP-type RNA binding protein OS=Drosophila melanogaster OX=7227 GN=bru1 PE=1 SV=1
18	Q8IP90	2.29e-135	412	810	0.480	0.301	Q8IP90_DROME Bruno 1, isoform B OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
19	Q5SZQ8	3.14e-133	396	465	0.451	0.492	CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens OX=9606 GN=CELF3 PE=1 SV=1
20	Q8CIN6	1.34e-132	394	465	0.451	0.492	CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus OX=10090 GN=Celf3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14703 PHM7_cyt	4.8	18.9	Cytosolic domain of 10TM putative phosphate transporter
2	PF08675 RNA_bind	2.4e-06	38.8	RNA binding domain
3	PF00076 RRM_1	1.2e-47	171.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	0.0067	27.9	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9767.XP_007167482.1

Rank	PPI partner	STRING score	Description
1	9767.XP_007188202.1	0.652	Muscleblind-like protein 1-like isoform X1
2	9767.XP_007196894.1	0.612	Muscleblind like splicing regulator 2
3	9767.XP_007174590.1	0.608	Muscleblind-like protein 3 isoform X1
4	9767.XP_007185139.1	0.607	Belongs to the PKI family
5	9767.XP_007195761.1	0.607	Family with sequence similarity 150 member B
6	9767.XP_007169468.1	0.596	WD repeat domain 77
7	9767.XP_007182919.1	0.596	WD repeat domain 33
8	9767.XP_007165748.1	0.589	RNA-binding protein that regulates alternative splicing events
9	9767.XP_007173694.1	0.589	Ribonucleotide reductase catalytic subunit M1
10	9767.XP_007196183.1	0.583	Apolipoprotein B mRNA editing enzyme catalytic subunit 1
11	9767.XP_007185088.1	0.579	Sulfatase 1
12	9767.XP_007176707.1	0.573	Polypyrimidine tract-binding protein 1 isoform X1
13	9767.XP_007168351.1	0.571	Coiled-coil domain containing 155
14	9767.XP_007186212.1	0.571	FERM domain-containing protein 6-like
15	9767.XP_007191593.1	0.571	CKLF-like MARVEL transmembrane domain-containing protein 8 isoform X1
16	9767.XP_007182792.1	0.551	Glutamate receptor ionotropic, NMDA 1 isoform X1
17	9767.XP_007189328.1	0.541	Kelch domain containing 7B
18	9767.XP_007169299.1	0.540	KH-type splicing regulatory protein
19	9767.XP_007188428.1	0.535	poly(A)-specific ribonuclease PARN isoform X1
20	9767.XP_007196687.1	0.519	Belongs to the DEAD box helicase family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003729	0.997	mRNA binding
GO:0005515	0.972	protein binding
GO:0003730	0.761	mRNA 3'-UTR binding
GO:0042802	0.349	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0000398	0.989	mRNA splicing, via spliceosome
GO:0043933	0.988	protein-containing complex organization
GO:0071826	0.962	ribonucleoprotein complex subunit organization
GO:0000245	0.952	spliceosomal complex assembly
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0050794	0.904	regulation of cellular process
GO:0006376	0.895	mRNA splice site selection
GO:0048519	0.869	negative regulation of biological process
GO:0048523	0.744	negative regulation of cellular process
GO:0051171	0.713	regulation of nitrogen compound metabolic process
GO:0031323	0.710	regulation of cellular metabolic process
GO:0080090	0.706	regulation of primary metabolic process
GO:0010605	0.696	negative regulation of macromolecule metabolic process
GO:0010468	0.353	regulation of gene expression
GO:0051248	0.331	negative regulation of protein metabolic process
GO:0031324	0.318	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.987	cytoplasm
GO:0005654	0.986	nucleoplasm
GO:0030496	0.766	midbody
GO:0090543	0.761	Flemming body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]