StarFunc result for job id O95340

User Input

>input (614 residues)
MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISF
ALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITS
FISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDS
DYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAE
AETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVL
PVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTCTKHPHIKMVM
ESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHAL
LMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAI
FPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAP
GLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKA
WKVLTDYYRSLEKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88428	0.981	0.970	0.000	621	0.922	0.911	O88428.pdb.gz	PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus OX=10090 GN=Papss2 PE=1 SV=2
2	AFDB:B2RYI8	0.653	0.643	1.018E-101	624	0.762	0.750	B2RYI8.pdb.gz	B2RYI8_RAT Papss1 protein OS=Rattus norvegicus OX=10116 GN=Papss1 PE=2 SV=1
3	AFDB:Q27128	0.872	0.877	5.986E-100	610	0.704	0.708	Q27128.pdb.gz	PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo OX=6431 PE=1 SV=1
4	AFDB:Q8IQV1	0.871	0.818	1.199E-93	657	0.625	0.584	Q8IQV1.pdb.gz	Q8IQV1_DROME PAPS synthetase, isoform D OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
5	PDB:1xjqB	0.644	0.669	1.253E-92	590	0.751	0.781	1xjqB.pdb.gz	The crystal structure of human PAPS synthetase 1 reveals asymmetry in substrate binding
6	PDB:1x6vA	0.762	0.823	6.053E-89	564	0.704	0.766	1x6vA.pdb.gz	The Crystal Structure of Human PAPS Synthetase 1 Reveals Asymmetry in Substrate Binding
7	AFDB:Q22501	0.732	0.693	2.367E-86	652	0.586	0.552	Q22501.pdb.gz
8	AFDB:Q9S7D8	0.628	0.820	1.580E-58	469	0.386	0.505	Q9S7D8.pdb.gz	APS4_ARATH ATP sulfurylase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS4 PE=1 SV=1
9	AFDB:O23324	0.629	0.830	8.427E-58	465	0.393	0.518	O23324.pdb.gz	APS3_ARATH ATP-sulfurylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS3 PE=1 SV=1
10	AFDB:Q9LIK9	0.625	0.828	2.720E-57	463	0.401	0.531	Q9LIK9.pdb.gz	APS1_ARATH ATP sulfurylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS1 PE=1 SV=1
11	AFDB:Q43870	0.629	0.810	4.754E-57	476	0.389	0.502	Q43870.pdb.gz	APS2_ARATH ATP sulfurylase 2 OS=Arabidopsis thaliana OX=3702 GN=APS2 PE=1 SV=1
12	AFDB:Q9SDP4	0.627	0.833	5.620E-57	461	0.384	0.512	Q9SDP4.pdb.gz	Q9SDP4_ALLCE sulfate adenylyltransferase OS=Allium cepa OX=4679 PE=1 SV=1
13	PDB:1j70A	0.564	0.673	3.412E-30	512	0.163	0.195	1j70A.pdb.gz	Structural and functional analysis of a truncated form of Saccharomyces cerevisiae ATP sulfurylase: C-terminal domain essential for oligomer formation but not for activity.
14	PDB:1m7gC	0.287	0.826	1.941E-18	209	0.171	0.502	1m7gC.pdb.gz	Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
15	PDB:1d6jB	0.258	0.834	4.171E-13	182	0.142	0.478	1d6jB.pdb.gz
16	PDB:1ko5A	0.204	0.640	2.811E-5	172	0.049	0.174	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
17	PDB:2axnA	0.205	0.271	1.982E-4	451	0.049	0.067	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
18	PDB:1bifA	0.222	0.305	2.620E-4	432	0.049	0.069	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
19	PDB:1e2fA	0.180	0.455	2.620E-4	210	0.042	0.124	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
20	PDB:2cdnA	0.200	0.539	4.841E-4	186	0.050	0.167	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RYI8	0.0	1025	624	0.762	0.750	B2RYI8_RAT Papss1 protein OS=Rattus norvegicus OX=10116 GN=Papss1 PE=2 SV=1
2	B5DFH4	0.0	1192	614	0.928	0.928	B5DFH4_RAT 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Rattus norvegicus OX=10116 GN=Papss2 PE=1 SV=1
3	O43252	0.0	1030	624	0.767	0.755	PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2
4	O88428	0.0	1182	621	0.922	0.911	PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus OX=10090 GN=Papss2 PE=1 SV=2
5	O95340	0.0	1282	614	1.000	1.000	PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens OX=9606 GN=PAPSS2 PE=1 SV=2
6	Q27128	0.0	946	610	0.705	0.710	PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo OX=6431 PE=1 SV=1
7	Q60967	0.0	1028	624	0.765	0.753	PAPS1_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus OX=10090 GN=Papss1 PE=1 SV=1
8	Q7KUT8	0.0	811	630	0.632	0.616	Q7KUT8_DROME PAPS synthetase, isoform E OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
9	Q8IQV1	0.0	812	657	0.634	0.592	Q8IQV1_DROME PAPS synthetase, isoform D OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
10	Q961A8	0.0	816	629	0.640	0.625	Q961A8_DROME LD25351p OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
11	Q9UIR2	0.0	535	265	0.419	0.970	Q9UIR2_HUMAN ATP sulfurylase/APS kinase isoform SK2 (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
12	Q9VW48	0.0	805	629	0.630	0.615	Q9VW48_DROME Bifunctional ATP sulfurylase/APS kinase OS=Drosophila melanogaster OX=7227 GN=Papss PE=2 SV=3
13	Q9LIK9	6.15e-180	519	463	0.401	0.531	APS1_ARATH ATP sulfurylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS1 PE=1 SV=1
14	O23324	4.19e-177	512	465	0.393	0.518	APS3_ARATH ATP-sulfurylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS3 PE=1 SV=1
15	Q43870	1.12e-176	511	476	0.389	0.502	APS2_ARATH ATP sulfurylase 2 OS=Arabidopsis thaliana OX=3702 GN=APS2 PE=1 SV=1
16	Q9S7D8	1.87e-174	505	469	0.388	0.507	APS4_ARATH ATP sulfurylase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS4 PE=1 SV=1
17	Q9SDP4	2.85e-170	494	461	0.376	0.501	Q9SDP4_ALLCE sulfate adenylyltransferase OS=Allium cepa OX=4679 PE=1 SV=1
18	Q9P7G9	6.87e-68	221	202	0.169	0.515	KAPS_SCHPO Adenylyl-sulfate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met14 PE=3 SV=1
19	Q92203	2.57e-64	212	206	0.174	0.519	KAPS_EMENI Adenylyl-sulfate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sD PE=3 SV=2
20	Q02196	5.59e-64	211	202	0.161	0.490	KAPS_YEAST Adenylyl-sulfate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13238 AAA_18	5.6	18.9	AAA domain
2	PF13671 AAA_33	0.1	24.2	AAA domain
3	PF01583 APS_kinase	5.9e-68	239.2	Adenylylsulphate kinase
4	PF01747 ATP-sulfurylase	5e-65	230.5	ATP-sulfurylase
5	PF17568 DUF5474	4.5e+02	12.3	Family of unknown function (DUF5474)
6	PF01293 PEPCK_ATP	3.1e+02	11.5	Phosphoenolpyruvate carboxykinase
7	PF14306 PUA_2	3.1e-49	178.1	PUA-like domain
8	PF03193 RsgA_GTPase	5e+02	12.0	RsgA GTPase
9	PF01514 YscJ_FliF	7.4e+02	11.4	Secretory protein of YscJ/FliF family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262644	0.953	Inositol monophosphatase 3
2	9606.ENSP00000446828	0.948	3'(2'),5'-bisphosphate nucleotidase 1
3	9606.ENSP00000377668	0.942	Sulfite oxidase, mitochondrial
4	9606.ENSP00000269445	0.923	Dymeclin
5	9606.ENSP00000265174	0.911	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
6	9606.ENSP00000217182	0.782	Elongation factor 1-alpha 2
7	9606.ENSP00000292180	0.780	FAD synthase
8	9606.ENSP00000286298	0.768	Sulfate transporter
9	9606.ENSP00000222002	0.766	Bile salt sulfotransferase
10	9606.ENSP00000339063	0.766	Elongation factor 1-alpha 1
11	9606.ENSP00000319622	0.742	Sulfotransferase 1C2
12	9606.ENSP00000258991	0.673	Testis-expressed protein 2
13	9606.ENSP00000253925	0.656	Liprin-alpha-1
14	9606.ENSP00000260324	0.643	Sulfide:quinone oxidoreductase, mitochondrial
15	9606.ENSP00000375899	0.635	Nuclear body protein SP140
16	9606.ENSP00000303222	0.631	Mitochondrial carrier homolog 2
17	9606.ENSP00000325634	0.624	Zinc finger protein 639
18	9606.ENSP00000335082	0.617	Protein FAM91A1
19	9606.ENSP00000226444	0.601	Estrogen sulfotransferase
20	9606.ENSP00000338475	0.589	Succinate--hydroxymethylglutarate CoA-transferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0004781	1.000	sulfate adenylyltransferase (ATP) activity
GO:0016301	0.999	kinase activity
GO:0004020	0.979	adenylylsulfate kinase activity
GO:0005488	0.785	binding
GO:0005515	0.779	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006790	0.990	sulfur compound metabolic process
GO:1901564	0.985	organonitrogen compound metabolic process
GO:0006753	0.985	nucleoside phosphate metabolic process
GO:1901135	0.982	carbohydrate derivative metabolic process
GO:0072521	0.973	purine-containing compound metabolic process
GO:0033865	0.973	nucleoside bisphosphate metabolic process
GO:0033875	0.955	ribonucleoside bisphosphate metabolic process
GO:0034032	0.955	purine nucleoside bisphosphate metabolic process
GO:0019693	0.949	ribose phosphate metabolic process
GO:0009150	0.943	purine ribonucleotide metabolic process
GO:0043436	0.898	oxoacid metabolic process
GO:0009058	0.865	biosynthetic process
GO:0044249	0.835	cellular biosynthetic process
GO:0044272	0.832	sulfur compound biosynthetic process
GO:0006164	0.770	purine nucleotide biosynthetic process
GO:0034033	0.766	purine nucleoside bisphosphate biosynthetic process
GO:0034030	0.762	ribonucleoside bisphosphate biosynthetic process
GO:0009152	0.759	purine ribonucleotide biosynthetic process
GO:0065007	0.581	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.988	cytosol
GO:0043227	0.379	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:18133	1.000	ATP + H(+) + sulfate = adenosine 5'-phosphosulfate + diphosphate
EC:2.7.7.4	1.000	sulfate adenylyltransferase.
RHEA:24152	0.979	adenosine 5'-phosphosulfate + ATP = 3'-phosphoadenylyl sulfate + ADP + H(+)
EC:2.7.1.25	0.979	adenylyl-sulfate kinase.

[back to server]