StarFunc result for job id O95342

User Input

>input (1321 residues)
MSDSVILRSIKKFGEENDGFESDKSYNNDKKSRLQDEKKGDGVRVGFFQLFRFSSSTDIW
LMFVGSLCAFLHGIAQPGVLLIFGTMTDVFIDYDVELQELQIPGKACVNNTIVWTNSSLN
QNMTNGTRCGLLNIESEMIKFASYYAGIAVAVLITGYIQICFWVIAAARQIQKMRKFYFR
RIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQMALFIQRMTSTICGFLLGFFRGWK
LTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISSMRTVAAFGGEKRE
VERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWYGSTLVLDEGEYTPGTLV
QIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRKPIIDCMSEDGYKLDRIKGEI
EFHNVTFHYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVT
VDGHDIRSLNIQWLRDQIGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKEANAYNF
IMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEAMVQEV
LSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVERGTHEELLERKGVYFTLVTLQSQG
NQALNEEDIKDATEDDMLARTFSRGSYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST
YEEDRKDKDIPVQEEVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQIL
GTFSIPDKEEQRSQINGVCLLFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAML
GQDIAWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL
SLVILCFFPFLALSGATQTRMLTGFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFI
EALETELEKPFKTAIQKANIYGFCFAFAQCIMFIANSASYRYGGYLISNEGLHFSYVFRV
ISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDF
VDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMID
GHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDF
VMSLPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQVA
LDKAREGRTCIVIAHRLSTIQNADIIAVMAQGVVIEKGTHEELMAQKGAYYKLVTTGSPI
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4m1mA	0.854	0.948	0.000	1188	0.469	0.521	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
2	PDB:6lr0U	0.846	0.905	0.000	1230	0.930	0.998	6lr0U.pdb.gz
3	PDB:6qexA	0.785	0.870	0.000	1182	0.484	0.541	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
4	PDB:7dv5U	0.847	0.937	0.000	1189	0.899	0.999	7dv5U.pdb.gz	Structures of human bile acid exporter ABCB11 reveal a transport mechanism facilitated by two tandem substrate-binding pockets.
5	AFDB:A0A2R8QDG3	0.899	0.880	0.000	1350	0.477	0.467	A0A2R8QDG3.pdb.gz
6	AFDB:A4D1D2	0.880	0.908	0.000	1280	0.496	0.512	A4D1D2.pdb.gz	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
7	AFDB:B5X0E4	0.882	0.927	0.000	1255	0.425	0.448	B5X0E4.pdb.gz	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
8	AFDB:B8K1W2	0.989	0.987	0.000	1325	0.896	0.893	B8K1W2.pdb.gz	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
9	AFDB:E7EZD3	0.927	0.936	0.000	1308	0.696	0.703	E7EZD3.pdb.gz
10	AFDB:E7F1E3	0.904	0.936	0.000	1275	0.497	0.515	E7F1E3.pdb.gz	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
11	AFDB:G5EDF9	0.879	0.912	0.000	1272	0.376	0.391	G5EDF9.pdb.gz	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
12	AFDB:O70127	0.973	0.973	0.000	1321	0.824	0.824	O70127.pdb.gz	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
13	AFDB:O80725	0.877	0.900	0.000	1286	0.372	0.382	O80725.pdb.gz	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
14	AFDB:O95342	1.000	1.000	0.000	1321	1.000	1.000	O95342.pdb.gz	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
15	PDB:7niwA	0.769	0.881	1.201E-99	1140	0.460	0.533	7niwA.pdb.gz	Structures of ABCB4 provide insight into phosphatidylcholine translocation.
16	PDB:4f4cA	0.742	0.780	9.716E-95	1250	0.372	0.393	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
17	PDB:7vluA	0.533	0.585	1.333E-47	1159	0.166	0.189	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
18	PDB:7s5xE	0.534	0.508	1.396E-46	1412	0.171	0.160	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
19	PDB:6jb1B	0.630	0.612	2.837E-46	1366	0.166	0.160	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
20	PDB:7mpeA	0.663	0.619	3.709E-45	1428	0.179	0.165	7mpeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6F1	698	721	0.275	0.503	A0A8I5Y6F1_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
2	A0A8I5ZY39	1271	1248	0.479	0.507	A0A8I5ZY39_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
3	A0A8I6GMN6	1269	1243	0.483	0.513	A0A8I6GMN6_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
4	A0MH69	1828	1336	0.693	0.686	A0MH69_ONCMY Bile salt export pump OS=Oncorhynchus mykiss OX=8022 GN=Abcb11 PE=2 SV=2
5	A4D1D2	1340	1280	0.497	0.512	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
6	B5X0E4	1128	1255	0.437	0.460	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
7	B8K1W2	2450	1325	0.896	0.894	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
8	E7F1E3	1329	1275	0.491	0.509	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
9	F1R7A8	1271	1338	0.475	0.469	F1R7A8_DANRE ABC transporter B family member 5 (Fragment) OS=Danio rerio OX=7955 GN=abcb5 PE=1 SV=1
10	F7FKA8	1278	1286	0.484	0.497	F7FKA8_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
11	G5EDF9	940	1272	0.378	0.392	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
12	G5EG61	758	1327	0.347	0.345	G5EG61_CAEEL p-GlycoProtein related OS=Caenorhabditis elegans OX=6239 GN=pgp-14 PE=1 SV=1
13	M9PEB5	889	1206	0.355	0.389	M9PEB5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=AMT PE=4 SV=1
14	O70127	2260	1321	0.824	0.824	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
15	O80725	896	1286	0.377	0.387	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
16	O93437	1290	1288	0.494	0.507	O93437_CHICK ABC transporter protein (P-glycoprotein) OS=Gallus gallus OX=9031 GN=cmdr1 PE=2 SV=2
17	O95342	2735	1321	1.000	1.000	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
18	P06795	1300	1276	0.478	0.495	MDR1B_MOUSE ATP-dependent translocase ABCB1 OS=Mus musculus OX=10090 GN=Abcb1b PE=1 SV=1
19	P08183	1340	1280	0.497	0.512	MDR1_HUMAN ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=1 SV=3
20	P21439	1276	1286	0.491	0.504	MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens OX=9606 GN=ABCB4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	0.073	24.2	AAA ATPase domain
2	PF13191 AAA_16	0.004	29.0	AAA ATPase domain
3	PF13238 AAA_18	1.1e+02	14.7	AAA domain
4	PF13304 AAA_21	0.48	21.7	AAA domain, putative AbiEii toxin, Type IV TA system
5	PF13401 AAA_22	0.0017	30.1	AAA domain
6	PF13476 AAA_23	22	17.0	AAA domain
7	PF13479 AAA_24	95	14.2	AAA domain
8	PF13481 AAA_25	35	15.4	AAA domain
9	PF13521 AAA_28	2e+02	13.6	AAA domain
10	PF13555 AAA_29	0.0084	27.2	P-loop containing region of AAA domain
11	PF13604 AAA_30	0.051	24.8	AAA domain
12	PF13671 AAA_33	19	16.8	AAA domain
13	PF07728 AAA_5	43	15.5	AAA domain (dynein-related subfamily)
14	PF12775 AAA_7	95	14.0	P-loop containing dynein motor region
15	PF09818 ABC_ATPase	0.0034	28.1	ATPase of the ABC class
16	PF00664 ABC_membrane	3.9e-122	418.8	ABC transporter transmembrane region
17	PF00005 ABC_tran	5e-69	242.6	ABC transporter
18	PF00503 G-alpha	65	14.1	G-protein alpha subunit
19	PF19044 P-loop_TraG	3.7e+02	11.1	TraG P-loop domain
20	PF00485 PRK	4.1e+02	12.2	Phosphoribulokinase / Uridine kinase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263817

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445359	0.919	Phospholipid-transporting ATPase IC
2	9606.ENSP00000447149	0.903	Bile acid receptor
3	9606.ENSP00000216540	0.900	Sodium/bile acid cotransporter
4	9606.ENSP00000301645	0.876	Cholesterol 7-alpha-monooxygenase
5	9606.ENSP00000254227	0.863	Nuclear receptor subfamily 0 group B member 2
6	9606.ENSP00000256958	0.856	Solute carrier organic anion transporter family member 1B1
7	9606.ENSP00000318867	0.833	7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
8	9606.ENSP00000296327	0.831	Organic solute transporter subunit alpha
9	9606.ENSP00000335292	0.810	Organic solute transporter subunit beta
10	9606.ENSP00000261196	0.804	Solute carrier organic anion transporter family member 1B3
11	9606.ENSP00000441269	0.798	Solute carrier organic anion transporter family member
12	9606.ENSP00000245312	0.789	Ileal sodium/bile acid cotransporter
13	9606.ENSP00000305974	0.783	Solute carrier organic anion transporter family member 1A2
14	9606.ENSP00000259407	0.735	Bile acid-CoA:amino acid N-acyltransferase
15	9606.ENSP00000336528	0.729	Nuclear receptor subfamily 1 group I member 2
16	9606.ENSP00000258415	0.703	Sterol 26-hydroxylase, mitochondrial
17	9606.ENSP00000377549	0.686	Gastrotropin
18	9606.ENSP00000310721	0.678	25-hydroxycholesterol 7-alpha-hydroxylase
19	9606.ENSP00000289575	0.677	Solute carrier organic anion transporter family member 2B1
20	9606.ENSP00000222002	0.672	Bile salt sulfotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140359	0.999	ABC-type transporter activity
GO:0015125	0.999	bile acid transmembrane transporter activity
GO:0042910	0.993	xenobiotic transmembrane transporter activity
GO:0005515	0.989	protein binding
GO:0008559	0.957	ABC-type xenobiotic transporter activity
GO:0015432	0.439	ABC-type bile acid transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.996	localization
GO:0015718	0.993	monocarboxylic acid transport
GO:0006869	0.959	lipid transport
GO:0015850	0.957	organic hydroxy compound transport
GO:0015721	0.934	bile acid and bile salt transport
GO:0009987	0.726	cellular process
GO:0008152	0.686	metabolic process
GO:0071704	0.573	organic substance metabolic process
GO:0046903	0.486	secretion
GO:0065007	0.450	biological regulation
GO:0050896	0.399	response to stimulus
GO:0050789	0.378	regulation of biological process
GO:0044237	0.361	cellular metabolic process
GO:0042221	0.348	response to chemical
GO:0044238	0.334	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.840	intracellular anatomical structure
GO:0043231	0.817	intracellular membrane-bounded organelle
GO:0005737	0.801	cytoplasm
GO:0045177	0.614	apical part of cell
GO:0098590	0.374	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	1.000	Translocases.
EC:7.6.2.2	0.957	ABC-type xenobiotic transporter.
RHEA:50048	0.439	ATP + cholate(in) + H2O = ADP + cholate(out) + H(+) + phosphate

[back to server]