StarFunc result for job id O95347

User Input

>input (1197 residues)
MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRAS
NLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGV
NANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIA
AQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFL
LAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLE
DALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEKEVKKITDGLH
ALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLE
KRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTA
LELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGP
DNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPH
GTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWE
MKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKM
KNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
EQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTN
NPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIE
DLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKE
NLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQF
IVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R158	0.523	0.523	0.000	1197	1.000	1.000	A0A024R158.pdb.gz
2	AFDB:P50533	0.386	0.384	0.000	1203	0.807	0.803	P50533.pdb.gz	SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis OX=8355 GN=smc2 PE=1 SV=1
3	AFDB:Q5B0N1	0.449	0.455	0.000	1179	0.402	0.408	Q5B0N1.pdb.gz	Q5B0N1_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05899 PE=3 SV=1
4	AFDB:Q7KK96	0.360	0.365	0.000	1179	0.398	0.404	Q7KK96.pdb.gz	Q7KK96_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC2 PE=1 SV=1
5	AFDB:P38989	0.375	0.383	1.199E-98	1170	0.353	0.361	P38989.pdb.gz	SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC2 PE=1 SV=1
6	AFDB:P41003	0.362	0.369	2.259E-98	1172	0.354	0.362	P41003.pdb.gz	SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut14 PE=1 SV=2
7	AFDB:Q09591	0.519	0.504	1.195E-88	1244	0.316	0.304	Q09591.pdb.gz	MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans OX=6239 GN=mix-1 PE=1 SV=2
8	AFDB:Q389U3	0.507	0.514	2.628E-78	1175	0.261	0.266	Q389U3.pdb.gz	Q389U3_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0600 PE=3 SV=1
9	PDB:6yvuA	0.350	0.366	4.016E-66	1127	0.338	0.358	6yvuA.pdb.gz
10	AFDB:Q8TZY2	0.355	0.361	2.161E-62	1177	0.226	0.230	Q8TZY2.pdb.gz	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2
11	AFDB:P47037	0.330	0.322	1.786E-61	1230	0.217	0.211	P47037.pdb.gz	SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC3 PE=1 SV=1
12	PDB:6yvuB	0.313	0.314	1.922E-43	1191	0.201	0.202	6yvuB.pdb.gz
13	PDB:7qenA	0.312	0.759	2.575E-34	465	0.217	0.559	7qenA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
14	PDB:6wg3B	0.316	0.528	3.385E-31	693	0.160	0.276	6wg3B.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
15	PDB:7qcdA	0.217	0.250	6.866E-30	1028	0.149	0.173	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	PDB:7q2xA	0.306	0.801	3.175E-29	431	0.213	0.592	7q2xA.pdb.gz	Clamping of DNA shuts the condensin neck gate.
17	PDB:7qcdB	0.275	0.321	5.263E-25	998	0.145	0.173	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:6wg3A	0.242	0.500	1.102E-24	561	0.141	0.301	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
19	PDB:7ogtB	0.213	0.304	4.484E-20	708	0.106	0.179	7ogtB.pdb.gz
20	PDB:6wgeB	0.286	0.677	1.134E-15	490	0.117	0.286	6wgeB.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95347	0.0	2443	1197	1.000	1.000	SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2
2	P38989	0.0	725	1170	0.367	0.375	SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC2 PE=1 SV=1
3	P41003	0.0	766	1172	0.363	0.371	SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut14 PE=1 SV=2
4	P50533	0.0	2003	1203	0.807	0.803	SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis OX=8355 GN=smc2 PE=1 SV=1
5	Q5B0N1	0.0	885	1179	0.413	0.419	Q5B0N1_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05899 PE=3 SV=1
6	Q7KK96	0.0	921	1179	0.402	0.408	Q7KK96_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC2 PE=1 SV=1
7	Q8CG48	0.0	2216	1191	0.916	0.921	SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus OX=10090 GN=Smc2 PE=1 SV=2
8	Q8T0F9	0.0	630	985	0.292	0.354	Q8T0F9_DROME LD05471p (Fragment) OS=Drosophila melanogaster OX=7227 GN=SMC2 PE=2 SV=2
9	Q09591	1.14e-179	564	1244	0.338	0.326	MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans OX=6239 GN=mix-1 PE=1 SV=2
10	O93309	1.18e-71	264	1209	0.267	0.265	SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis OX=8355 GN=smc3 PE=1 SV=2
11	P51834	3.54e-70	259	1186	0.277	0.279	SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) OX=224308 GN=smc PE=1 SV=3
12	Q9CW03	3.87e-67	250	1217	0.266	0.262	SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus OX=10090 GN=Smc3 PE=1 SV=2
13	Q9UQE7	3.94e-67	250	1217	0.266	0.262	SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2
14	Q8AWB8	5.64e-67	249	1217	0.266	0.261	Q8AWB8_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC3 PE=2 SV=1
15	Q00737	1.10e-66	248	1215	0.259	0.255	SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sudA PE=2 SV=3
16	Q9X0R4	5.59e-65	243	1170	0.261	0.268	Q9X0R4_THEMA Chromosome partition protein Smc OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=smc PE=1 SV=1
17	P97690	3.36e-64	241	1191	0.255	0.256	SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus OX=10116 GN=Smc3 PE=1 SV=1
18	Q803N2	4.77e-62	234	1216	0.254	0.250	Q803N2_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=wu:fc30d07 PE=1 SV=1
19	Q389U3	1.61e-61	232	1175	0.174	0.177	Q389U3_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0600 PE=3 SV=1
20	A0A0H2UQ93	2.21e-60	229	1179	0.265	0.269	A0A0H2UQ93_STRPN Chromosome partition protein Smc OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=smc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	2.7e-08	45.4	AAA ATPase domain
2	PF13304 AAA_21	1.6e-07	43.1	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13555 AAA_29	3.3	18.8	P-loop containing region of AAA domain
4	PF01025 GrpE	83	14.3	GrpE
5	PF06470 SMC_hinge	2.4e-19	81.1	SMC proteins Flexible Hinge Domain
6	PF02463 SMC_N	9.2e-62	219.9	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240423	0.999	Condensin complex subunit 2
2	9606.ENSP00000251496	0.999	Condensin complex subunit 3
3	9606.ENSP00000299821	0.999	Condensin-2 complex subunit H2
4	9606.ENSP00000325017	0.999	Condensin complex subunit 1
5	9606.ENSP00000349961	0.999	Structural maintenance of chromosomes protein 4
6	9606.ENSP00000433681	0.999	Condensin-2 complex subunit D3
7	9606.ENSP00000387007	0.998	Condensin-2 complex subunit G2
8	9606.ENSP00000378699	0.994	Cyclin-dependent kinase 1
9	9606.ENSP00000261597	0.983	Kinetochore protein NDC80 homolog
10	9606.ENSP00000354720	0.982	Structural maintenance of chromosomes protein 3
11	9606.ENSP00000411532	0.981	DNA topoisomerase 2-alpha
12	9606.ENSP00000323421	0.980	Structural maintenance of chromosomes protein 1A
13	9606.ENSP00000260731	0.976	Kinesin-like protein KIF11
14	9606.ENSP00000256442	0.975	G2/mitotic-specific cyclin-B1
15	9606.ENSP00000288207	0.972	G2/mitotic-specific cyclin-B2
16	9606.ENSP00000313950	0.969	Aurora kinase B
17	9606.ENSP00000356379	0.967	Abnormal spindle-like microcephaly-associated protein
18	9606.ENSP00000265148	0.965	Centromere-associated protein E
19	9606.ENSP00000368349	0.965	DNA polymerase alpha catalytic subunit
20	9606.ENSP00000358813	0.963	Dual specificity protein kinase TTK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.929	nucleic acid binding
GO:0003677	0.912	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006996	0.997	organelle organization
GO:0050794	0.995	regulation of cellular process
GO:0051276	0.994	chromosome organization
GO:0007049	0.985	cell cycle
GO:0007059	0.948	chromosome segregation
GO:0048518	0.946	positive regulation of biological process
GO:0048522	0.944	positive regulation of cellular process
GO:0098813	0.940	nuclear chromosome segregation
GO:0000280	0.938	nuclear division
GO:0030261	0.936	chromosome condensation
GO:0000278	0.928	mitotic cell cycle
GO:1903047	0.734	mitotic cell cycle process
GO:0008152	0.614	metabolic process
GO:0000819	0.590	sister chromatid segregation
GO:0071704	0.583	organic substance metabolic process
GO:0044238	0.579	primary metabolic process
GO:0006807	0.560	nitrogen compound metabolic process
GO:0043170	0.490	macromolecule metabolic process
GO:0044237	0.483	cellular metabolic process
GO:0140014	0.457	mitotic nuclear division
GO:0000070	0.437	mitotic sister chromatid segregation
GO:0050896	0.420	response to stimulus
GO:0051128	0.405	regulation of cellular component organization
GO:0033044	0.360	regulation of chromosome organization
GO:0006139	0.337	nucleobase-containing compound metabolic process
GO:0010564	0.333	regulation of cell cycle process
GO:0090304	0.328	nucleic acid metabolic process
GO:0044260	0.327	cellular macromolecule metabolic process
GO:0051716	0.323	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005829	0.997	cytosol
GO:0005694	0.997	chromosome
GO:0044815	0.944	DNA packaging complex
GO:0000796	0.875	condensin complex
GO:0005730	0.685	nucleolus
GO:0000228	0.458	nuclear chromosome
GO:0000793	0.449	condensed chromosome
GO:0005576	0.347	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]