StarFunc result for job id O95352

User Input

>input (703 residues)
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYERE
GFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KPR3	0.928	0.918	0.000	711	0.696	0.688	A0A0G2KPR3.pdb.gz
2	AFDB:F7ESQ7	0.562	0.594	0.000	664	0.930	0.985	F7ESQ7.pdb.gz	F7ESQ7_MACMU Ubiquitin-like modifier-activating enzyme ATG7 OS=Macaca mulatta OX=9544 GN=ATG7 PE=3 SV=2
3	AFDB:O95352	1.000	1.000	0.000	703	1.000	1.000	O95352.pdb.gz	ATG7_HUMAN Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7 PE=1 SV=1
4	AFDB:Q86CR9	0.864	0.859	5.508E-83	707	0.414	0.412	Q86CR9.pdb.gz	ATG7_DICDI Ubiquitin-like modifier-activating enzyme atg7 OS=Dictyostelium discoideum OX=44689 GN=atg7 PE=3 SV=1
5	AFDB:Q94CD5	0.873	0.880	2.390E-82	697	0.448	0.452	Q94CD5.pdb.gz	ATG7_ARATH Ubiquitin-like modifier-activating enzyme atg7 OS=Arabidopsis thaliana OX=3702 GN=ATG7 PE=1 SV=1
6	AFDB:Q7JY94	0.858	0.881	1.116E-75	684	0.398	0.409	Q7JY94.pdb.gz	Q7JY94_DROME Ubiquitin-like modifier-activating enzyme ATG7 OS=Drosophila melanogaster OX=7227 GN=Atg7 PE=1 SV=1
7	AFDB:O93922	0.821	0.878	3.696E-74	654	0.376	0.404	O93922.pdb.gz	ATG7_PICPA Ubiquitin-like modifier-activating enzyme ATG7 OS=Komagataella pastoris OX=4922 GN=ATG7 PE=1 SV=1
8	AFDB:G5EBK4	0.516	0.558	1.224E-72	647	0.397	0.431	G5EBK4.pdb.gz	G5EBK4_CAEEL Ubiquitin-like modifier-activating enzyme ATG7 OS=Caenorhabditis elegans OX=6239 GN=atg-7 PE=1 SV=1
9	AFDB:O43069	0.495	0.535	1.553E-71	649	0.381	0.413	O43069.pdb.gz	ATG7_SCHPO Ubiquitin-like modifier-activating enzyme atg7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg7 PE=3 SV=2
10	AFDB:P38862	0.779	0.863	2.845E-63	630	0.356	0.397	P38862.pdb.gz	ATG7_YEAST Ubiquitin-like modifier-activating enzyme ATG7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG7 PE=1 SV=1
11	PDB:4gslA	0.446	0.520	2.231E-56	598	0.350	0.411	4gslA.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
12	PDB:4gskB	0.432	0.526	2.135E-55	572	0.333	0.409	4gskB.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
13	PDB:1jw9B	0.282	0.786	1.177E-11	240	0.070	0.204	1jw9B.pdb.gz	Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
14	PDB:1zfnA	0.269	0.735	1.177E-11	244	0.068	0.197	1zfnA.pdb.gz	Structural Analysis of Escherichia Coli ThiF.
15	PDB:3h5aC	0.300	0.556	1.493E-10	358	0.088	0.173	3h5aC.pdb.gz	How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
16	PDB:6xoiB	0.198	0.339	3.945E-9	403	0.047	0.082	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
17	PDB:3kycB	0.197	0.251	4.945E-9	548	0.051	0.066	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.
18	PDB:2nvuB	0.279	0.250	9.201E-9	789	0.083	0.074	2nvuB.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
19	PDB:7solA	0.200	0.141	1.366E-8	1011	0.058	0.041	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
20	PDB:1y8rA	0.266	0.551	2.846E-8	314	0.073	0.162	1y8rA.pdb.gz	Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7ESQ7	0.0	1345	664	0.933	0.988	F7ESQ7_MACMU Ubiquitin-like modifier-activating enzyme ATG7 OS=Macaca mulatta OX=9544 GN=ATG7 PE=3 SV=2
2	O95352	0.0	1460	703	1.000	1.000	ATG7_HUMAN Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7 PE=1 SV=1
3	Q641Y5	0.0	1363	698	0.926	0.933	ATG7_RAT Ubiquitin-like modifier-activating enzyme ATG7 OS=Rattus norvegicus OX=10116 GN=Atg7 PE=2 SV=1
4	Q94CD5	0.0	587	697	0.457	0.461	ATG7_ARATH Ubiquitin-like modifier-activating enzyme atg7 OS=Arabidopsis thaliana OX=3702 GN=ATG7 PE=1 SV=1
5	Q9D906	0.0	1360	698	0.925	0.931	ATG7_MOUSE Ubiquitin-like modifier-activating enzyme ATG7 OS=Mus musculus OX=10090 GN=Atg7 PE=1 SV=1
6	Q86CR9	2.61e-179	530	707	0.425	0.423	ATG7_DICDI Ubiquitin-like modifier-activating enzyme atg7 OS=Dictyostelium discoideum OX=44689 GN=atg7 PE=3 SV=1
7	Q7JY94	1.85e-168	501	684	0.407	0.418	Q7JY94_DROME Ubiquitin-like modifier-activating enzyme ATG7 OS=Drosophila melanogaster OX=7227 GN=Atg7 PE=1 SV=1
8	G5EBK4	1.07e-161	482	647	0.394	0.428	G5EBK4_CAEEL Ubiquitin-like modifier-activating enzyme ATG7 OS=Caenorhabditis elegans OX=6239 GN=atg-7 PE=1 SV=1
9	O43069	6.79e-156	468	649	0.400	0.433	ATG7_SCHPO Ubiquitin-like modifier-activating enzyme atg7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg7 PE=3 SV=2
10	O93922	1.63e-153	461	654	0.378	0.407	ATG7_PICPA Ubiquitin-like modifier-activating enzyme ATG7 OS=Komagataella pastoris OX=4922 GN=ATG7 PE=1 SV=1
11	P38862	7.10e-139	423	630	0.374	0.417	ATG7_YEAST Ubiquitin-like modifier-activating enzyme ATG7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG7 PE=1 SV=1
12	A1ZBA9	2.20e-131	399	510	0.289	0.398	A1ZBA9_DROME Autophagy-related 7, isoform B OS=Drosophila melanogaster OX=7227 GN=Atg7 PE=4 SV=1
13	Q389M1	3.19e-95	313	754	0.272	0.253	Q389M1_TRYB2 Ubiquitin activating E1 enzyme, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0840 PE=4 SV=1
14	O65041	3.80e-06	52.4	454	0.041	0.064	UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=ECR1 PE=1 SV=2
15	Q9SJT1	1.05e-05	51.2	700	0.041	0.041	SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SAE2 PE=1 SV=1
16	Q9UBT2	1.74e-05	50.4	640	0.044	0.048	SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2
17	P12282	3.57e-05	48.1	249	0.067	0.189	MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=moeB PE=1 SV=1
18	Q8C878	8.64e-05	48.1	462	0.041	0.063	UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus OX=10090 GN=Uba3 PE=1 SV=2
19	Q99MI7	8.72e-05	48.1	462	0.041	0.063	UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Uba3 PE=1 SV=1
20	Q8TBC4	9.28e-05	47.8	463	0.041	0.063	UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16420 ATG7_N	3.1e-101	350.7	Ubiquitin-like modifier-activating enzyme ATG7 N-terminus
2	PF01488 Shikimate_DH	4.2e+02	12.4	Shikimate / quinate 5-dehydrogenase
3	PF00899 ThiF	6.6e-54	194.0	ThiF family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346437

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000037243	0.999	Gamma-aminobutyric acid receptor-associated protein-like 2
2	9606.ENSP00000266458	0.999	Gamma-aminobutyric acid receptor-associated protein-like 1
3	9606.ENSP00000268607	0.999	Microtubule-associated proteins 1A/1B light chain 3B
4	9606.ENSP00000282185	0.999	Ubiquitin-like-conjugating enzyme ATG10
5	9606.ENSP00000283290	0.999	Ubiquitin-like-conjugating enzyme ATG3
6	9606.ENSP00000306866	0.999	Gamma-aminobutyric acid receptor-associated protein
7	9606.ENSP00000425107	0.999	Ubiquitin-like protein ATG12
8	9606.ENSP00000358072	0.998	Autophagy protein 5
9	9606.ENSP00000368880	0.998	Forkhead box protein O1
10	9606.ENSP00000363970	0.995	Microtubule-associated proteins 1A/1B light chain 3A
11	9606.ENSP00000212015	0.984	NAD-dependent protein deacetylase sirtuin-1
12	9606.ENSP00000354340	0.979	NEDD8-activating enzyme E1 catalytic subunit
13	9606.ENSP00000375872	0.976	Autophagy-related protein 16-1
14	9606.ENSP00000269305	0.972	Cellular tumor antigen p53
15	9606.ENSP00000355231	0.972	Beclin-1
16	9606.ENSP00000313454	0.966	Ubiquitin-like modifier-activating enzyme 6
17	9606.ENSP00000288828	0.961	WD repeat domain phosphoinositide-interacting protein 2
18	9606.ENSP00000338413	0.956	Ubiquitin-like modifier-activating enzyme 1
19	9606.ENSP00000330237	0.955	Caspase-9
20	9606.ENSP00000349785	0.955	Microtubule-associated proteins 1A/1B light chain 3C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016874	1.000	ligase activity
GO:0042803	1.000	protein homodimerization activity
GO:0140096	0.999	catalytic activity, acting on a protein
GO:0008641	0.989	ubiquitin-like modifier activating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0061919	0.996	process utilizing autophagic mechanism
GO:0050789	0.989	regulation of biological process
GO:0006914	0.987	autophagy
GO:0071704	0.962	organic substance metabolic process
GO:0050794	0.954	regulation of cellular process
GO:0044238	0.883	primary metabolic process
GO:0019222	0.869	regulation of metabolic process
GO:0006807	0.863	nitrogen compound metabolic process
GO:0043170	0.826	macromolecule metabolic process
GO:0050896	0.811	response to stimulus
GO:0019538	0.780	protein metabolic process
GO:0048518	0.777	positive regulation of biological process
GO:0051716	0.751	cellular response to stimulus
GO:0048522	0.749	positive regulation of cellular process
GO:0009894	0.637	regulation of catabolic process
GO:0060255	0.635	regulation of macromolecule metabolic process
GO:0080090	0.605	regulation of primary metabolic process
GO:0009893	0.598	positive regulation of metabolic process
GO:0051171	0.589	regulation of nitrogen compound metabolic process
GO:0071840	0.585	cellular component organization or biogenesis
GO:0016043	0.576	cellular component organization
GO:0048519	0.575	negative regulation of biological process
GO:0031323	0.510	regulation of cellular metabolic process
GO:0006996	0.504	organelle organization
GO:0042221	0.484	response to chemical
GO:0009605	0.466	response to external stimulus
GO:0006950	0.451	response to stress
GO:0009896	0.435	positive regulation of catabolic process
GO:0070887	0.369	cellular response to chemical stimulus
GO:0036211	0.367	protein modification process
GO:0007154	0.353	cell communication
GO:0048523	0.328	negative regulation of cellular process
GO:0010604	0.323	positive regulation of macromolecule metabolic process
GO:0031667	0.321	response to nutrient levels
GO:0031325	0.321	positive regulation of cellular metabolic process
GO:0051246	0.319	regulation of protein metabolic process
GO:0033554	0.314	cellular response to stress
GO:0016236	0.303	macroautophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0070013	0.995	intracellular organelle lumen
GO:0012505	0.993	endomembrane system
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005634	0.972	nucleus
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0031981	0.958	nuclear lumen
GO:0016020	0.954	membrane
GO:0005576	0.929	extracellular region
GO:0031982	0.910	vesicle
GO:0031410	0.892	cytoplasmic vesicle
GO:0005654	0.814	nucleoplasm
GO:0032991	0.702	protein-containing complex
GO:0005615	0.691	extracellular space
GO:0070062	0.530	extracellular exosome
GO:0030141	0.511	secretory granule
GO:0071944	0.495	cell periphery
GO:0042995	0.454	cell projection
GO:0120025	0.423	plasma membrane bounded cell projection
GO:0048471	0.366	perinuclear region of cytoplasm
GO:0005886	0.335	plasma membrane
GO:0005773	0.327	vacuole
GO:0034774	0.327	secretory granule lumen
GO:1904813	0.317	ficolin-1-rich granule lumen
GO:0005856	0.306	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	1.000	Ligases.
EC:6.2.-.-	0.991	Forming carbon-sulfur bonds.

[back to server]