StarFunc result for job id O95359

User Input

>input (1400 residues)
MGNENSTSDNQRTLSAQTPRSAQPPGNSQNIKRKQQDTPGSPDHRDASSIGSVGLGGFCT
ASESSASLDPCLVSPEVTEPRKDPQGARGPEGSLLPSPPPSQEREHPSSSMPFAECPPEG
CLASPAAAPEDGPQTQSPRREPAPNAPGDIAAAFPAERDSSTPYQEIAAVPSAGRERQPK
EEGQKSSFSFSSGIDQSPGMSPVPLREPMKAPLCGEGDQPGGFESQEKEAAGGFPPAESR
QGVASVQVTPEAPAAAQQGTESSAVLEKSPLKPMAPIPQDPAPRASDRERGQGEAPPQYL
TDDLEFLRACHLPRSNSGAAPEAEVNAASQESCQQPVGAYLPHAELPWGLPSPALVPEAG
GSGKEALDTIDVQGHPQTGMRGTKPNQVVCVAAGGQPEGGLPVSPEPSLLTPTEEAHPAS
SLASFPAAQIPIAVEEPGSSSRESVSKAGMPVSADAAKEVVDAGLVGLERQVSDLGSKGE
HPEGDPGEVPAPSPQERGEHLNTEQSHEVQPGVPPPPLPKEQSHEVQPGAPPPPLPKAPS
ESARGPPGPTDGAKVHEDSTSPAVAKEGSRSPGDSPGGKEEAPEPPDGGDPGNLQGEDSQ
AFSSKRDPEVGKDELSKPSSDAESRDHPSSHSAQPPRKGGAGHTDGPHSQTAEADASGLP
HKLGEEDPVLPPVPDGAGEPTVPEGAIWEGSGLQPKCPDTLQSREGLGRMESFLTLESEK
SDFPPTPVAEVAPKAQEGESTLEIRKMGSCDGEGLLTSPDQPRGPACDASRQEFHAGVPH
PPQGENLAADLGLTALILDQDQQGIPSCPGEGWIRGAASEWPLLSSEKHLQPSQAQPETS
IFDVLKEQAQPPENGKETSPSHPGFKDQGADSSQIHVPVEPQEDNNLPTHGGQEQALGSE
LQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSR
VSPPAADVLKDFSLAGNFSRKETCCTGQGPNKSQQALADALEEGSQHEEACQRHPGASEA
ADGCSPLWGLSKREMASGNTGEAPPCQPDSVALLDAVPCLPALAPASPGVTPTQDAPETE
ACDETQEGRQQPVPAPQQKMECWATSDAESPKLLASFPSAGEQGGEAGAAETGGSAGAGD
PGKQQAPEKPGEATLSCGLLQTEHCLTSGEEASTSALRESCQAEHPMASCQDALLPAREL
GGIPRSTMDFSTHQAVPDPKELLLSGPPEVAAPDTPYLHVDSAAQRGAEDSGVKAVSSAD
PRAPGESPCPVGEPPLALENAASLKLFAGSLAPLLQPGAAGGEIPAVQASSGSPKARTTE
GPVDSMPCLDRMPLLAKGKQATGEEKAATAPGAGAKASGEGMAGDAAGETEGSMERMGEP
SQDPKQGTSGGVDTSSEQIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08572	0.031	0.027	2.739E-2	1712	0.204	0.167	P08572.pdb.gz	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
2	AFDB:Q9C0C2	0.031	0.027	1.340E-1	1729	0.209	0.169	Q9C0C2.pdb.gz	TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4
3	AFDB:O55103	0.038	0.038	1.649E-1	1391	0.191	0.193	O55103.pdb.gz	PRAX_MOUSE Periaxin OS=Mus musculus OX=10090 GN=Prx PE=1 SV=1
4	AFDB:Q9UKL3	0.033	0.027	4.045E-1	1982	0.161	0.114	Q9UKL3.pdb.gz	C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens OX=9606 GN=CASP8AP2 PE=1 SV=1
5	AFDB:D4A7V6	0.039	0.029	4.334E-1	1962	0.155	0.111	D4A7V6.pdb.gz	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1
6	AFDB:Q9IA31	0.034	0.032	6.559E-1	1544	0.157	0.142	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
7	AFDB:Q9FMM3	0.033	0.028	9.263E-1	1714	0.167	0.137	Q9FMM3.pdb.gz	EXA1_ARATH Protein ESSENTIAL FOR POTEXVIRUS ACCUMULATION 1 OS=Arabidopsis thaliana OX=3702 GN=EXA1 PE=1 SV=1
8	AFDB:P02461	0.040	0.038	9.926E-1	1466	0.169	0.162	P02461.pdb.gz	CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens OX=9606 GN=COL3A1 PE=1 SV=4
9	AFDB:P48754	0.030	0.029	9.926E-1	1812	0.174	0.135	P48754.pdb.gz	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
10	AFDB:F1QH64	0.028	0.031	1.064	1225	0.140	0.160	F1QH64.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RWP4	0.0	2758	2826	0.999	0.495	B2RWP4_HUMAN TACC2 protein OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
2	E7EMZ9	0.0	2759	2826	1.000	0.495	E7EMZ9_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
3	E9PBC6	0.0	2763	2875	1.000	0.487	E9PBC6_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
4	O95359	0.0	2766	2948	1.000	0.475	TACC2_HUMAN Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3
5	Q9JJG0	3.96e-08	60.5	1149	0.020	0.024	TACC2_MOUSE Transforming acidic coiled-coil-containing protein 2 OS=Mus musculus OX=10090 GN=Tacc2 PE=1 SV=2
6	Q86X29	0.38	37.7	649	0.024	0.051	LSR_HUMAN Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358001

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432768	0.969	Cytoskeleton-associated protein 5
2	9606.ENSP00000321703	0.756	Transforming acidic coiled-coil-containing protein 1
3	9606.ENSP00000247843	0.753	YEATS domain-containing protein 4
4	9606.ENSP00000391641	0.733	Zinc finger protein 780B
5	9606.ENSP00000312399	0.690	Coiled-coil domain-containing protein 63
6	9606.ENSP00000384312	0.680	TRIO and F-actin-binding protein
7	9606.ENSP00000302640	0.650	Nucleolar transcription factor 1
8	9606.ENSP00000363817	0.646	Retinoic acid receptor RXR-beta
9	9606.ENSP00000302898	0.614	Aurora kinase C
10	9606.ENSP00000354671	0.595	Microtubule-associated serine/threonine-protein kinase 2
11	9606.ENSP00000400997	0.583	Zinc finger protein 780A
12	9606.ENSP00000267163	0.561	Retinoblastoma-associated protein
13	9606.ENSP00000350549	0.554	Homeobox protein HMX3
14	9606.ENSP00000400258	0.554	Disks large-associated protein 2
15	9606.ENSP00000480514	0.550	Calcium load-activated calcium channel
16	9606.ENSP00000259239	0.532	U3 small nucleolar ribonucleoprotein protein IMP4
17	9606.ENSP00000280481	0.531	FRAS1-related extracellular matrix protein 2
18	9606.ENSP00000373647	0.522	Protein FAM83G
19	9606.ENSP00000216911	0.510	Aurora kinase A
20	9606.ENSP00000358715	0.507	Sortilin related VPS10 domain containing receptor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.891	biological regulation
GO:0050789	0.868	regulation of biological process
GO:0009987	0.861	cellular process
GO:0050794	0.831	regulation of cellular process
GO:0032501	0.314	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]