StarFunc result for job id O95361

User Input

>input (564 residues)
MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDS
DSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLT
EPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQ
LDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEK
EQAALSQANGIKAHLEYRSAEMEKSKQELERMAAISNTVQFLEEYCKFKNTEDITFPSVY
VGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAVVQRKYWTSKP
EPSTREQFLQYAYDITFDPDTAHKYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLS
QQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWY
SDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKE
NAIRIVDLGEEPEKPAPSLVGTAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95361	1.000	1.000	2.242E-100	564	1.000	1.000	O95361.pdb.gz	TRI16_HUMAN Tripartite motif-containing protein 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=3
2	AFDB:Q99PP9	0.734	0.743	1.461E-81	556	0.777	0.788	Q99PP9.pdb.gz	TRI16_MOUSE Tripartite motif-containing protein 16 OS=Mus musculus OX=10090 GN=Trim16 PE=1 SV=2
3	AFDB:H0Y626	0.398	0.258	1.624E-57	953	0.759	0.449	H0Y626.pdb.gz	H0Y626_HUMAN B box-type domain-containing protein OS=Homo sapiens OX=9606 PE=4 SV=2
4	AFDB:A2BFT4	0.402	0.396	1.775E-41	573	0.268	0.264	A2BFT4.pdb.gz
5	AFDB:F1QZK7	0.374	0.326	1.185E-38	664	0.245	0.208	F1QZK7.pdb.gz
6	AFDB:Q61510	0.388	0.353	8.719E-37	634	0.223	0.199	Q61510.pdb.gz	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
7	AFDB:D4A9N5	0.389	0.351	1.244E-35	643	0.227	0.199	D4A9N5.pdb.gz	D4A9N5_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=1 SV=3
8	AFDB:A0A0R4IKI3	0.326	0.287	1.474E-35	654	0.234	0.202	A0A0R4IKI3.pdb.gz
9	AFDB:Q14258	0.386	0.353	2.746E-35	630	0.238	0.213	Q14258.pdb.gz	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
10	AFDB:Q96LD4	0.316	0.279	3.499E-34	638	0.243	0.215	Q96LD4.pdb.gz	TRI47_HUMAN E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47 PE=1 SV=2
11	PDB:7y4sA	0.297	0.478	4.000E-16	343	0.113	0.187	7y4sA.pdb.gz
12	PDB:4b3nA	0.268	0.272	2.464E-11	557	0.066	0.066	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7nscA	0.242	0.471	3.243E-8	276	0.051	0.105	7nscA.pdb.gz
14	PDB:7ccbA	0.227	0.714	9.496E-8	164	0.039	0.134	7ccbA.pdb.gz
15	PDB:7nsba	0.202	0.201	3.040E-5	568	0.087	0.086	7nsba.pdb.gz
16	PDB:6swy1	0.187	0.194	3.602E-5	542	0.064	0.066	6swy1.pdb.gz
17	PDB:3o12A	0.173	0.417	1.116E-4	185	0.032	0.097	3o12A.pdb.gz
18	PDB:7m6aA	0.169	0.023	1.116E-4	4306	0.035	0.005	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
19	PDB:7ua3A	0.163	0.023	1.857E-4	4443	0.034	0.004	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:2fmdA	0.214	0.448	4.337E-4	232	0.030	0.073	2fmdA.pdb.gz	Structural basis of carbohydrate recognition by a Man(alpha1-2)Man-specific lectin from Bowringia milbraedii.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3KP96	0.0	814	434	0.693	0.901	B3KP96_HUMAN Tripartite motif containing 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=1
2	H0Y626	0.0	883	953	0.762	0.451	H0Y626_HUMAN B box-type domain-containing protein OS=Homo sapiens OX=9606 PE=4 SV=2
3	O95361	0.0	1178	564	1.000	1.000	TRI16_HUMAN Tripartite motif-containing protein 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=3
4	Q99PP9	0.0	900	556	0.778	0.790	TRI16_MOUSE Tripartite motif-containing protein 16 OS=Mus musculus OX=10090 GN=Trim16 PE=1 SV=2
5	K7ENN8	2.97e-173	491	232	0.411	1.000	K7ENN8_HUMAN Tripartite motif containing 16 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=1
6	Q08CC1	9.47e-72	242	573	0.277	0.272	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
7	Q8C0E3	1.36e-43	166	641	0.229	0.201	TRI47_MOUSE E3 ubiquitin-protein ligase TRIM47 OS=Mus musculus OX=10090 GN=Trim47 PE=1 SV=2
8	Q96LD4	1.62e-42	163	638	0.229	0.202	TRI47_HUMAN E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47 PE=1 SV=2
9	A0A0R4IUT0	4.31e-41	158	544	0.229	0.237	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
10	Q14134	1.81e-31	130	588	0.135	0.129	TRI29_HUMAN Tripartite motif-containing protein 29 OS=Homo sapiens OX=9606 GN=TRIM29 PE=1 SV=2
11	Q8R2Q0	2.86e-31	130	587	0.135	0.129	TRI29_MOUSE Tripartite motif-containing protein 29 OS=Mus musculus OX=10090 GN=Trim29 PE=1 SV=1
12	Q0P6H7	1.16e-29	124	446	0.133	0.168	Q0P6H7_HUMAN TRIM29 protein OS=Homo sapiens OX=9606 GN=TRIM29 PE=1 SV=2
13	F1QYX5	4.59e-27	117	582	0.172	0.167	F1QYX5_DANRE Bloodthirsty-related gene family, member 1 OS=Danio rerio OX=7955 GN=btr01 PE=4 SV=2
14	A0A024RCP5	7.02e-27	116	518	0.215	0.234	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
15	Q9HCM9	7.02e-27	116	518	0.215	0.234	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
16	A0A1U9X8R9	6.00e-24	107	513	0.225	0.248	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
17	P14373	6.00e-24	107	513	0.225	0.248	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
18	Q62158	9.20e-24	107	513	0.225	0.248	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
19	A0A2R8QTG3	2.68e-22	103	645	0.122	0.107	A0A2R8QTG3_DANRE E3 ubiquitin/ISG15 ligase TRIM25 isoform X1 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
20	Q7ZVQ7	7.94e-22	102	654	0.117	0.101	Q7ZVQ7_DANRE E3 ubiquitin/ISG15 ligase TRIM25 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13765 PRY	4.1e-13	60.0	SPRY-associated domain
2	PF00622 SPRY	4.5e-10	51.1	SPRY domain
3	PF00643 zf-B_box	0.0015	29.9	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463188

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254301	0.977	Galectin-3
2	9606.ENSP00000263341	0.866	Interleukin-1 beta
3	9606.ENSP00000295756	0.714	T-cell receptor-associated transmembrane adapter 1
4	9606.ENSP00000435460	0.714	Galectin 8
5	9606.ENSP00000223369	0.707	Synaptobrevin homolog YKT6
6	9606.ENSP00000306866	0.693	Gamma-aminobutyric acid receptor-associated protein
7	9606.ENSP00000375872	0.653	Autophagy-related protein 16-1
8	9606.ENSP00000463393	0.651	Vesicle-trafficking protein SEC22b
9	9606.ENSP00000433102	0.647	Tripartite motif-containing protein 3
10	9606.ENSP00000267843	0.642	Fibroblast growth factor 7
11	9606.ENSP00000264664	0.608	Fibroblast growth factor 10
12	9606.ENSP00000263182	0.604	Gamma-butyrobetaine dioxygenase
13	9606.ENSP00000344215	0.604	Tumor protein p53-inducible nuclear protein 1
14	9606.ENSP00000479488	0.583	Prohibitin
15	9606.ENSP00000378306	0.559	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
16	9606.ENSP00000464030	0.556	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
17	9606.ENSP00000268058	0.525	Protein PML
18	9606.ENSP00000296503	0.524	High mobility group protein B2
19	9606.ENSP00000461386	0.520	Tripartite motif-containing protein 16-like protein
20	9606.ENSP00000410446	0.517	Tripartite motif-containing protein 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.881	heterocyclic compound binding
GO:0097159	0.881	organic cyclic compound binding
GO:0003676	0.765	nucleic acid binding
GO:0003677	0.593	DNA binding
GO:0019904	0.585	protein domain specific binding
GO:0019838	0.531	growth factor binding
GO:0019955	0.522	cytokine binding
GO:0003824	0.395	catalytic activity
GO:0032089	0.324	NACHT domain binding
GO:0019966	0.302	interleukin-1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0050896	0.992	response to stimulus
GO:0010468	0.985	regulation of gene expression
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031325	0.975	positive regulation of cellular metabolic process
GO:0010647	0.951	positive regulation of cell communication
GO:0010604	0.945	positive regulation of macromolecule metabolic process
GO:0023051	0.940	regulation of signaling
GO:0048583	0.937	regulation of response to stimulus
GO:0019219	0.930	regulation of nucleobase-containing compound metabolic process
GO:0036211	0.930	protein modification process
GO:0010556	0.929	regulation of macromolecule biosynthetic process
GO:0031326	0.929	regulation of cellular biosynthetic process
GO:0009966	0.927	regulation of signal transduction
GO:0042221	0.912	response to chemical
GO:0006355	0.907	regulation of DNA-templated transcription
GO:0001817	0.903	regulation of cytokine production
GO:0009967	0.902	positive regulation of signal transduction
GO:0009987	0.868	cellular process
GO:0010033	0.856	response to organic substance
GO:0051173	0.722	positive regulation of nitrogen compound metabolic process
GO:0018205	0.719	peptidyl-lysine modification
GO:0016570	0.696	histone modification
GO:1901700	0.668	response to oxygen-containing compound
GO:0043966	0.626	histone H3 acetylation
GO:0045935	0.597	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.593	negative regulation of biological process
GO:0009719	0.532	response to endogenous stimulus
GO:0010628	0.529	positive regulation of gene expression
GO:0045682	0.520	regulation of epidermis development
GO:0051716	0.487	cellular response to stimulus
GO:0006950	0.483	response to stress
GO:0009725	0.461	response to hormone
GO:0045595	0.450	regulation of cell differentiation
GO:0051254	0.418	positive regulation of RNA metabolic process
GO:0009605	0.408	response to external stimulus
GO:1902680	0.406	positive regulation of RNA biosynthetic process
GO:0044419	0.399	biological process involved in interspecies interaction between organisms
GO:0045893	0.398	positive regulation of DNA-templated transcription
GO:0051707	0.394	response to other organism
GO:0065009	0.391	regulation of molecular function
GO:1902531	0.367	regulation of intracellular signal transduction
GO:0006952	0.365	defense response
GO:0002376	0.361	immune system process
GO:0033993	0.348	response to lipid
GO:2000026	0.346	regulation of multicellular organismal development
GO:0001819	0.344	positive regulation of cytokine production
GO:0030856	0.328	regulation of epithelial cell differentiation
GO:0048523	0.320	negative regulation of cellular process
GO:0043967	0.307	histone H4 acetylation
GO:0032501	0.302	multicellular organismal process
GO:0010243	0.301	response to organonitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.970	cytosol
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0005654	0.963	nucleoplasm
GO:0016020	0.915	membrane
GO:0071944	0.827	cell periphery
GO:0005886	0.773	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]