StarFunc result for job id O95363

User Input

>input (451 residues)
MVGSALRRGAHAYVYLVSKASHISRGHQHQAWGSRPPAAECATQRAPGSVVELLGKSYPQ
DDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVV
TTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRR
DQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVE
FDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVN
SAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKY
PAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRH
MERTLSQREVRHIHQALQEAAVQLLGVEGRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95363	1.000	1.000	4.570E-92	451	1.000	1.000	O95363.pdb.gz	SYFM_HUMAN Phenylalanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=FARS2 PE=1 SV=1
2	PDB:5mguA	0.898	0.995	1.922E-77	407	0.898	0.995	5mguA.pdb.gz	Kinetic and structural changes in HsmtPheRS, induced by pathogenic mutations in human FARS2.
3	AFDB:Q99M01	0.880	0.880	4.059E-75	451	0.851	0.851	Q99M01.pdb.gz	SYFM_MOUSE Phenylalanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Fars2 PE=1 SV=1
4	AFDB:Q6AYQ3	0.879	0.840	7.537E-74	472	0.856	0.818	Q6AYQ3.pdb.gz	SYFM_RAT Phenylalanine--tRNA ligase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fars2 PE=2 SV=1
5	AFDB:O16129	0.853	0.849	3.697E-56	453	0.499	0.497	O16129.pdb.gz	SYFM_DROME Probable phenylalanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=PheRS-m PE=2 SV=3
6	AFDB:Q94K73	0.758	0.796	4.370E-47	429	0.424	0.445	Q94K73.pdb.gz	SYFM_ARATH Phenylalanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g58140 PE=1 SV=1
7	AFDB:P08425	0.787	0.758	2.505E-43	469	0.357	0.343	P08425.pdb.gz	SYFM_YEAST Phenylalanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSF1 PE=1 SV=3
8	AFDB:O74952	0.767	0.805	7.230E-42	429	0.361	0.380	O74952.pdb.gz	SYFM_SCHPO Phenylalanine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfs1 PE=3 SV=1
9	AFDB:C6KSN5	0.693	0.705	8.920E-34	443	0.313	0.318	C6KSN5.pdb.gz	C6KSN5_PLAF7 Phenylalanyl-tRNA synthetase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0603700 PE=3 SV=1
10	AFDB:Q9BRP7	0.651	0.480	1.798E-21	624	0.171	0.123	Q9BRP7.pdb.gz	FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FDXACB1 PE=1 SV=3
11	AFDB:P08312	0.455	0.622	8.064E-20	327	0.182	0.251	P08312.pdb.gz	SYFA_ECOLI Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12) OX=83333 GN=pheS PE=1 SV=2
12	PDB:7k98A	0.436	0.568	1.293E-16	343	0.171	0.224	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
13	PDB:3pcoC	0.450	0.621	1.612E-16	323	0.180	0.251	3pcoC.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
14	PDB:3tehA	0.429	0.704	9.938E-16	266	0.173	0.293	3tehA.pdb.gz	Bacterial and Eukaryotic Phenylalanyl-tRNA Synthetases Catalyze Misaminoacylation of tRNA(Phe) with 3,4-Dihydroxy-L-Phenylalanine.
15	PDB:3l4gC	0.435	0.389	1.673E-13	508	0.153	0.136	3l4gC.pdb.gz	Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.
16	PDB:7db7B	0.312	0.181	1.232E-11	836	0.146	0.079	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
17	PDB:3pcoB	0.295	0.178	2.523E-11	795	0.133	0.075	3pcoB.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
18	PDB:5x6cA	0.300	0.254	8.699E-9	539	0.104	0.087	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
19	PDB:2du4A	0.393	0.381	2.220E-8	466	0.104	0.101	2du4A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.
20	PDB:3dsqB	0.365	0.553	2.925E-8	282	0.095	0.152	3dsqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95363	0.0	944	451	1.000	1.000	SYFM_HUMAN Phenylalanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=FARS2 PE=1 SV=1
2	Q6AYQ3	0.0	812	472	0.863	0.824	SYFM_RAT Phenylalanine--tRNA ligase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fars2 PE=2 SV=1
3	Q99M01	0.0	816	451	0.851	0.851	SYFM_MOUSE Phenylalanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Fars2 PE=1 SV=1
4	O16129	7.44e-158	456	453	0.499	0.497	SYFM_DROME Probable phenylalanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=PheRS-m PE=2 SV=3
5	Q94K73	3.37e-120	359	429	0.404	0.424	SYFM_ARATH Phenylalanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g58140 PE=1 SV=1
6	O74952	5.35e-101	310	429	0.370	0.389	SYFM_SCHPO Phenylalanine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfs1 PE=3 SV=1
7	P08425	3.33e-100	309	469	0.364	0.350	SYFM_YEAST Phenylalanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSF1 PE=1 SV=3
8	P08312	6.49e-35	134	327	0.211	0.291	SYFA_ECOLI Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12) OX=83333 GN=pheS PE=1 SV=2
9	C6KSN5	1.04e-32	130	443	0.146	0.149	C6KSN5_PLAF7 Phenylalanyl-tRNA synthetase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0603700 PE=3 SV=1
10	Q728R9	1.41e-29	120	345	0.184	0.241	SYFA_DESVH Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=pheS PE=1 SV=1
11	P9WFU3	1.17e-23	103	341	0.224	0.296	SYFA_MYCTU Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pheS PE=1 SV=1
12	P27001	2.19e-23	102	350	0.175	0.226	SYFA_THETH Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus OX=274 GN=pheS PE=1 SV=1
13	Q9BRP7	2.14e-16	84.0	624	0.100	0.072	FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FDXACB1 PE=1 SV=3
14	Q8I5A1	1.78e-14	77.8	556	0.115	0.094	Q8I5A1_PLAF7 Phenylalanine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1232000 PE=3 SV=2
15	Q505J8	3.54e-09	61.2	508	0.157	0.140	SYFA_RAT Phenylalanine--tRNA ligase alpha subunit OS=Rattus norvegicus OX=10116 GN=Farsa PE=1 SV=1
16	O42870	9.68e-09	59.7	499	0.151	0.136	SYFA_SCHPO Phenylalanine--tRNA ligase alpha subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=frs2 PE=3 SV=3
17	Q9Y285	1.23e-08	59.3	508	0.155	0.138	SYFA_HUMAN Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA PE=1 SV=3
18	Q9W3J5	2.80e-08	58.2	498	0.155	0.141	SYFA_DROME Phenylalanine--tRNA ligase alpha subunit OS=Drosophila melanogaster OX=7227 GN=alpha-PheRS PE=1 SV=1
19	Q9T034	2.05e-07	55.5	485	0.140	0.130	SYFA_ARATH Phenylalanine--tRNA ligase alpha subunit, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g39280 PE=2 SV=3
20	P15625	3.85e-07	54.7	503	0.142	0.127	SYFA_YEAST Phenylalanine--tRNA ligase alpha subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRS2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03147 FDX-ACB	5.7e-19	79.7	Ferredoxin-fold anticodon binding domain
2	PF00152 tRNA-synt_2	16	16.0	tRNA synthetases class II (D, K and N)
3	PF01409 tRNA-synt_2d	4.6e-46	168.9	tRNA synthetases class II core domain (F)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281828	0.988	phenylalanyl-tRNA synthetase beta subunit
2	9606.ENSP00000362576	0.935	Tyrosine--tRNA ligase, cytoplasmic
3	9606.ENSP00000261772	0.918	Alanine--tRNA ligase, cytoplasmic
4	9606.ENSP00000408576	0.909	Probable leucine--tRNA ligase, mitochondrial
5	9606.ENSP00000320658	0.907	Tyrosine--tRNA ligase, mitochondrial
6	9606.ENSP00000320309	0.894	phenylalanyl-tRNA synthetase alpha subunit
7	9606.ENSP00000358549	0.893	Probable arginine--tRNA ligase, mitochondrial
8	9606.ENSP00000355889	0.886	Isoleucine--tRNA ligase, mitochondrial
9	9606.ENSP00000360327	0.886	Probable proline--tRNA ligase, mitochondrial
10	9606.ENSP00000281038	0.883	Probable asparagine--tRNA ligase, mitochondrial
11	9606.ENSP00000364815	0.880	Valine--tRNA ligase
12	9606.ENSP00000395196	0.880	Probable glutamate--tRNA ligase, mitochondrial
13	9606.ENSP00000472847	0.878	Serine--tRNA ligase, mitochondrial
14	9606.ENSP00000325448	0.876	Lysine--tRNA ligase
15	9606.ENSP00000441000	0.872	Valine--tRNA ligase, mitochondrial
16	9606.ENSP00000235521	0.867	Tryptophan--tRNA ligase, mitochondrial
17	9606.ENSP00000244571	0.849	Alanine--tRNA ligase, mitochondrial
18	9606.ENSP00000282276	0.839	Methionine--tRNA ligase, mitochondrial
19	9606.ENSP00000358060	0.823	Threonine--tRNA ligase, mitochondrial
20	9606.ENSP00000373918	0.813	Glycine--tRNA ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000049	1.000	tRNA binding
GO:0004826	1.000	phenylalanine-tRNA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044249	0.989	cellular biosynthetic process
GO:0034641	0.989	cellular nitrogen compound metabolic process
GO:1901360	0.987	organic cyclic compound metabolic process
GO:0046483	0.987	heterocycle metabolic process
GO:0010467	0.987	gene expression
GO:0006725	0.987	cellular aromatic compound metabolic process
GO:1901566	0.987	organonitrogen compound biosynthetic process
GO:0044260	0.985	cellular macromolecule metabolic process
GO:0019538	0.985	protein metabolic process
GO:0044271	0.982	cellular nitrogen compound biosynthetic process
GO:0006139	0.982	nucleobase-containing compound metabolic process
GO:0044281	0.967	small molecule metabolic process
GO:0009059	0.966	macromolecule biosynthetic process
GO:0043604	0.966	amide biosynthetic process
GO:0006412	0.949	translation
GO:0090304	0.945	nucleic acid metabolic process
GO:0006418	0.929	tRNA aminoacylation for protein translation
GO:0008033	0.801	tRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005759	0.824	mitochondrial matrix
GO:0031981	0.338	nuclear lumen
GO:0005829	0.320	cytosol
GO:0005654	0.314	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19413	1.000	ATP + L-phenylalanine + tRNA(Phe) = AMP + diphosphate + H(+) + L-phenylalanyl-tRNA(Phe)
EC:6.1.1.20	1.000	phenylalanine--tRNA ligase.

[back to server]