StarFunc result for job id O95365

User Input

>input (584 residues)
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS
HVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAA
ASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSN
PGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGA
AEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMDYYLKYFSGAH
DGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT
RQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKD
EDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95365	1.000	1.000	4.883E-93	584	1.000	1.000	O95365.pdb.gz	ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1
2	AFDB:Q9QZ48	0.373	0.380	2.835E-76	569	0.868	0.891	Q9QZ48.pdb.gz	ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus OX=10116 GN=Zbtb7a PE=1 SV=1
3	AFDB:Q8BID6	0.217	0.212	6.215E-21	600	0.245	0.238	Q8BID6.pdb.gz	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2
4	AFDB:Q8NCP5	0.209	0.214	2.191E-20	570	0.212	0.218	Q8NCP5.pdb.gz	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
5	AFDB:Q9WTY8	0.199	0.144	1.039E-15	836	0.185	0.129	Q9WTY8.pdb.gz	ZBT10_RAT Zinc finger and BTB domain-containing protein 10 OS=Rattus norvegicus OX=10116 GN=Zbtb10 PE=2 SV=1
6	AFDB:Q96DT7	0.202	0.138	2.317E-15	871	0.188	0.126	Q96DT7.pdb.gz	ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10 PE=1 SV=2
7	AFDB:Q80X44	0.193	0.163	3.536E-12	710	0.235	0.193	Q80X44.pdb.gz	ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus OX=10090 GN=Zbtb24 PE=1 SV=1
8	AFDB:O15062	0.192	0.166	6.270E-12	677	0.233	0.201	O15062.pdb.gz	ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1
9	AFDB:Q921B4	0.190	0.137	1.861E-11	824	0.123	0.087	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
10	AFDB:A0A024R087	0.145	0.144	1.971E-11	589	0.209	0.207	A0A024R087.pdb.gz
11	PDB:6wcqC	0.202	0.854	2.619E-9	130	0.062	0.277	6wcqC.pdb.gz
12	PDB:3w5kB	0.090	0.291	4.431E-5	110	0.075	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:7mk2A	0.180	0.280	3.483E-4	354	0.058	0.096	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
14	PDB:6sgaFS	0.125	0.253	8.031E-2	277	0.033	0.069	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
15	PDB:4z4kA	0.058	0.101	2.674E-1	282	0.024	0.050	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
16	PDB:6r7fQ	0.116	0.507	3.560E-1	112	0.031	0.161	6r7fQ.pdb.gz
17	PDB:2a79B	0.130	0.274	4.477E-1	259	0.036	0.081	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
18	PDB:7w6sB	0.119	0.152	4.740E-1	448	0.029	0.038	7w6sB.pdb.gz
19	PDB:3lutB	0.142	0.205	5.020E-1	390	0.051	0.077	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
20	PDB:5apnp	0.064	0.232	6.684E-1	91	0.026	0.165	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88939	0.0	919	569	0.875	0.898	ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus OX=10090 GN=Zbtb7a PE=1 SV=2
2	O95365	0.0	1192	584	1.000	1.000	ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1
3	Q9QZ48	0.0	938	569	0.868	0.891	ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus OX=10116 GN=Zbtb7a PE=1 SV=1
4	Q8VCZ7	9.41e-72	243	619	0.178	0.168	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
5	A1YPR0	2.58e-71	242	619	0.173	0.163	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
6	O15156	6.28e-56	199	539	0.161	0.174	ZBT7B_HUMAN Zinc finger and BTB domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZBTB7B PE=1 SV=2
7	Q64321	6.06e-54	194	544	0.152	0.164	ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus OX=10090 GN=Zbtb7b PE=1 SV=2
8	Q9NPC7	3.12e-38	151	610	0.238	0.228	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
9	Q99MD8	2.22e-36	145	610	0.231	0.221	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
10	P17141	1.08e-27	119	594	0.092	0.091	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
11	P08155	2.14e-27	119	845	0.084	0.058	KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster OX=7227 GN=Kr-h1 PE=2 SV=2
12	P13360	6.56e-27	117	604	0.077	0.075	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
13	O14978	8.02e-27	117	683	0.092	0.079	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
14	Q96MU6	9.86e-27	117	729	0.092	0.074	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
15	Q8WV37	3.07e-26	115	535	0.094	0.103	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
16	Q9ERU3	3.50e-26	109	237	0.101	0.249	ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus OX=10090 GN=Znf22 PE=1 SV=2
17	Q3ZBY5	3.72e-26	114	466	0.087	0.109	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
18	Q07231	4.18e-26	114	555	0.086	0.090	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
19	F8WEZ9	4.95e-26	114	492	0.094	0.112	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
20	Q8CF60	6.84e-26	114	680	0.089	0.076	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	8.8e-29	111.4	BTB/POZ domain
2	PF11672 DUF3268	2.1e+02	13.6	zinc-finger-containing domain
3	PF00096 zf-C2H2	7.6e-11	53.0	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	1e+02	14.1	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	6.4e-10	50.0	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	3.6	19.0	C2H2-type zinc finger
7	PF16293 zf-C2H2_9	1.1e+02	14.0	C2H2 type zinc-finger (1 copy)
8	PF13465 zf-H2C2_2	2.4e-20	83.2	Zinc-finger double domain
9	PF12874 zf-met	3.7e+02	12.9	Zinc-finger of C2H2 type
10	PF17032 zinc_ribbon_15	5.7e+02	12.7	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.977	Histone deacetylase 1
2	9606.ENSP00000384018	0.918	Nuclear receptor corepressor 2
3	9606.ENSP00000268712	0.840	Nuclear receptor corepressor 1
4	9606.ENSP00000269305	0.738	Cellular tumor antigen p53
5	9606.ENSP00000278823	0.697	Metastasis-associated protein MTA2
6	9606.ENSP00000378402	0.641	Paired amphipathic helix protein Sin3a
7	9606.ENSP00000367705	0.634	BCL-6 corepressor
8	9606.ENSP00000339063	0.631	Elongation factor 1-alpha 1
9	9606.ENSP00000329357	0.617	Transcription factor Sp1
10	9606.ENSP00000350676	0.610	Histone lysine demethylase PHF8
11	9606.ENSP00000384273	0.610	Transcription factor p65
12	9606.ENSP00000430432	0.583	Histone deacetylase 2
13	9606.ENSP00000362170	0.581	Nuclear apoptosis-inducing factor 1
14	9606.ENSP00000358576	0.559	5' exonuclease Apollo
15	9606.ENSP00000375942	0.544	TATA-box-binding protein
16	9606.ENSP00000336861	0.540	IQ domain-containing protein H
17	9606.ENSP00000369716	0.530	Chromodomain-helicase-DNA-binding protein 3
18	9606.ENSP00000370517	0.527	ATP-dependent 6-phosphofructokinase, platelet type
19	9606.ENSP00000382863	0.520	Chromodomain-helicase-DNA-binding protein 8
20	9606.ENSP00000385361	0.520	Immunoglobulin iota chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000977	0.995	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.993	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.954	transcription factor binding
GO:0061629	0.887	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000981	0.832	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001221	0.761	transcription coregulator binding
GO:0001222	0.658	transcription corepressor binding
GO:0016922	0.635	nuclear receptor binding
GO:0046332	0.584	SMAD binding
GO:0050681	0.578	nuclear androgen receptor binding
GO:0019899	0.513	enzyme binding
GO:0001217	0.390	DNA-binding transcription repressor activity
GO:0001227	0.349	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0042802	0.333	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0048523	0.991	negative regulation of cellular process
GO:0009987	0.953	cellular process
GO:0010605	0.906	negative regulation of macromolecule metabolic process
GO:0045934	0.900	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.889	negative regulation of RNA metabolic process
GO:1903507	0.879	negative regulation of nucleic acid-templated transcription
GO:0045892	0.869	negative regulation of DNA-templated transcription
GO:0006357	0.740	regulation of transcription by RNA polymerase II
GO:0008152	0.713	metabolic process
GO:0000122	0.704	negative regulation of transcription by RNA polymerase II
GO:0048583	0.684	regulation of response to stimulus
GO:0048518	0.648	positive regulation of biological process
GO:0032502	0.629	developmental process
GO:0048522	0.618	positive regulation of cellular process
GO:0010646	0.575	regulation of cell communication
GO:0071704	0.572	organic substance metabolic process
GO:0023051	0.543	regulation of signaling
GO:0009893	0.538	positive regulation of metabolic process
GO:0006807	0.527	nitrogen compound metabolic process
GO:0044237	0.526	cellular metabolic process
GO:0010604	0.525	positive regulation of macromolecule metabolic process
GO:0044238	0.512	primary metabolic process
GO:0050896	0.502	response to stimulus
GO:0009966	0.495	regulation of signal transduction
GO:0031325	0.478	positive regulation of cellular metabolic process
GO:0032501	0.471	multicellular organismal process
GO:0051173	0.470	positive regulation of nitrogen compound metabolic process
GO:0071840	0.469	cellular component organization or biogenesis
GO:0016043	0.458	cellular component organization
GO:0048856	0.445	anatomical structure development
GO:0009891	0.404	positive regulation of biosynthetic process
GO:0051716	0.400	cellular response to stimulus
GO:0045935	0.393	positive regulation of nucleobase-containing compound metabolic process
GO:0043170	0.385	macromolecule metabolic process
GO:0051254	0.379	positive regulation of RNA metabolic process
GO:0065009	0.372	regulation of molecular function
GO:0045893	0.357	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0031981	0.987	nuclear lumen
GO:0005654	0.981	nucleoplasm
GO:0032991	0.923	protein-containing complex
GO:0043232	0.805	intracellular non-membrane-bounded organelle
GO:0005737	0.698	cytoplasm
GO:0005694	0.468	chromosome
GO:1990234	0.398	transferase complex
GO:0061695	0.392	transferase complex, transferring phosphorus-containing groups
GO:0000118	0.386	histone deacetylase complex
GO:0016581	0.380	NuRD complex
GO:0070418	0.377	DNA-dependent protein kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]