StarFunc result for job id O95372

User Input

>input (231 residues)
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95372	1.000	1.000	3.753E-53	231	1.000	1.000	O95372.pdb.gz	LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1
2	PDB:5synA	0.952	0.985	1.920E-46	223	0.965	1.000	5synA.pdb.gz	Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
3	AFDB:O75608	0.936	0.941	1.634E-39	230	0.675	0.678	O75608.pdb.gz	LYPA1_HUMAN Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1
4	PDB:1fj2A	0.929	0.937	1.444E-34	229	0.658	0.664	1fj2A.pdb.gz
5	AFDB:M9PEW1	0.912	0.908	2.838E-32	232	0.502	0.500	M9PEW1.pdb.gz	M9PEW1_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
6	AFDB:O42881	0.884	0.911	1.230E-27	224	0.355	0.366	O42881.pdb.gz	APTH1_SCHPO Acyl-protein thioesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC8E11.04c PE=3 SV=1
7	AFDB:Q55FK4	0.912	0.948	4.027E-27	222	0.351	0.365	Q55FK4.pdb.gz	APT12_DICDI Acyl-protein thioesterase 1 homolog 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268064 PE=1 SV=1
8	AFDB:Q12354	0.865	0.880	6.376E-24	227	0.320	0.326	Q12354.pdb.gz	APTH1_YEAST Acyl-protein thioesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR118C PE=1 SV=1
9	AFDB:Q8L9X1	0.861	0.792	9.344E-23	252	0.333	0.306	Q8L9X1.pdb.gz	Q8L9X1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g20060 PE=1 SV=1
10	AFDB:Q3UFF7	0.850	0.823	8.844E-22	239	0.307	0.297	Q3UFF7.pdb.gz	LYPL1_MOUSE Lysophospholipase-like protein 1 OS=Mus musculus OX=10090 GN=Lyplal1 PE=1 SV=3
11	AFDB:Q84WK4	0.844	0.855	3.493E-21	228	0.294	0.298	Q84WK4.pdb.gz	SOBR1_ARATH Carboxylesterase SOBER1 OS=Arabidopsis thaliana OX=3702 GN=SOBER1 PE=1 SV=1
12	AFDB:Q5VWZ2	0.852	0.831	3.718E-21	237	0.307	0.300	Q5VWZ2.pdb.gz	LYPL1_HUMAN Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1 PE=1 SV=3
13	PDB:5kreA	0.847	0.873	3.817E-21	224	0.307	0.317	5kreA.pdb.gz	Discovery of a Selective Covalent Inhibitor of Lysophospholipase-like 1 (LYPLAL1) as a Tool to Evaluate the Role of this Serine Hydrolase in Metabolism.
14	PDB:6avvA	0.834	0.915	2.484E-20	210	0.290	0.319	6avvA.pdb.gz
15	PDB:1ycdB	0.660	0.642	7.327E-9	238	0.203	0.197	1ycdB.pdb.gz	Crystal structure of yeast YHR049W/FSH1, a member of the serine hydrolase family.
16	PDB:6eicB	0.601	0.506	1.143E-7	279	0.186	0.154	6eicB.pdb.gz
17	PDB:3fcxB	0.496	0.429	1.217E-7	275	0.195	0.164	3fcxB.pdb.gz	Crystal structure of human esterase D: a potential genetic marker of retinoblastoma
18	PDB:3m83A	0.547	0.405	1.378E-7	325	0.169	0.120	3m83A.pdb.gz	Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
19	PDB:7jn7A	0.498	0.163	1.883E-7	846	0.177	0.048	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
20	PDB:6y0fC	0.512	0.196	2.418E-7	722	0.152	0.048	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95372	2.79e-172	474	231	1.000	1.000	LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1
2	Q9WTL7	3.64e-171	472	231	0.991	0.991	LYPA2_MOUSE Acyl-protein thioesterase 2 OS=Mus musculus OX=10090 GN=Lypla2 PE=1 SV=1
3	O75608	3.10e-116	333	230	0.680	0.683	LYPA1_HUMAN Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1
4	Q6IAQ1	3.10e-116	333	230	0.680	0.683	Q6IAQ1_HUMAN palmitoyl-protein hydrolase OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1
5	P97823	2.61e-113	325	230	0.645	0.648	LYPA1_MOUSE Acyl-protein thioesterase 1 OS=Mus musculus OX=10090 GN=Lypla1 PE=1 SV=1
6	P70470	1.24e-112	323	230	0.645	0.648	LYPA1_RAT Acyl-protein thioesterase 1 OS=Rattus norvegicus OX=10116 GN=Lypla1 PE=1 SV=1
7	Q9I7R0	3.75e-79	238	216	0.506	0.542	Q9I7R0_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
8	C0PDF4	4.05e-79	238	221	0.506	0.529	C0PDF4_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
9	M9PEW1	9.19e-79	238	232	0.506	0.504	M9PEW1_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
10	O42881	1.50e-44	150	224	0.355	0.366	APTH1_SCHPO Acyl-protein thioesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC8E11.04c PE=3 SV=1
11	Q55FK4	6.99e-44	149	222	0.351	0.365	APT12_DICDI Acyl-protein thioesterase 1 homolog 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268064 PE=1 SV=1
12	Q12354	1.99e-40	140	227	0.316	0.322	APTH1_YEAST Acyl-protein thioesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR118C PE=1 SV=1
13	Q8L9X1	2.90e-37	132	252	0.342	0.313	Q8L9X1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g20060 PE=1 SV=1
14	Q8GYK2	2.72e-31	117	262	0.294	0.260	SOBRL_ARATH Probable carboxylesterase SOBER1-like OS=Arabidopsis thaliana OX=3702 GN=At4g22300 PE=2 SV=1
15	D6XM23	1.99e-29	113	280	0.325	0.268	D6XM23_TRYB2 Lysophospholipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.160 PE=4 SV=1
16	Q7YXI0	1.99e-29	113	280	0.325	0.268	Q7YXI0_9TRYP Lysophospholipase OS=Trypanosoma brucei OX=5691 PE=4 SV=1
17	Q9VGV9	5.23e-29	110	235	0.316	0.311	Q9VGV9_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6567 PE=1 SV=1
18	Q5VWZ2	1.68e-28	109	237	0.312	0.304	LYPL1_HUMAN Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1 PE=1 SV=3
19	Q84WK4	5.72e-28	107	228	0.286	0.289	SOBR1_ARATH Carboxylesterase SOBER1 OS=Arabidopsis thaliana OX=3702 GN=SOBER1 PE=1 SV=1
20	Q3UFF7	1.73e-25	101	239	0.290	0.280	LYPL1_MOUSE Lysophospholipase-like protein 1 OS=Mus musculus OX=10090 GN=Lyplal1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	0.065	24.5	alpha/beta hydrolase fold
2	PF02230 Abhydrolase_2	9.8e-86	298.6	Phospholipase/Carboxylesterase
3	PF07859 Abhydrolase_3	0.038	25.4	alpha/beta hydrolase fold
4	PF12697 Abhydrolase_6	0.011	27.9	Alpha/beta hydrolase family
5	PF20434 BD-FAE	16	16.5	BD-FAE
6	PF01083 Cutinase	4.9	18.6	Cutinase
7	PF01738 DLH	0.89	20.6	Dienelactone hydrolase family
8	PF11144 DUF2920	5.1e+02	11.2	Protein of unknown function (DUF2920)
9	PF00756 Esterase	2e+02	13.0	Putative esterase
10	PF03959 FSH1	5.1	18.2	Serine hydrolase (FSH1)
11	PF12146 Hydrolase_4	0.0023	28.8	Serine aminopeptidase, S33
12	PF01764 Lipase_3	5.5e+02	11.8	Lipase (class 3)
13	PF11187 Mbeg1-like	62	14.5	Mbeg1-like
14	PF02089 Palm_thioest	1.4e+02	13.7	Palmitoyl protein thioesterase
15	PF00326 Peptidase_S9	0.76	20.8	Prolyl oligopeptidase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000012846

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000001379	0.847	Phospholipase A2, group XVI
2	132908.ENSPVAP00000001780	0.839	Phospholipase B1
3	132908.ENSPVAP00000012461	0.839	Glycerophosphocholine phosphodiesterase GDE1 homolog (S. cerevisiae)
4	132908.ENSPVAP00000008811	0.826	Patatin-like phospholipase domain containing 7
5	132908.ENSPVAP00000010062	0.788	Abhydrolase domain containing 17C
6	132908.ENSPVAP00000012962	0.759	annotation not available
7	132908.ENSPVAP00000009859	0.694	UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
8	132908.ENSPVAP00000001155	0.693	Cerebral endothelial cell adhesion molecule
9	132908.ENSPVAP00000002378	0.677	Patatin-like phospholipase domain containing 6
10	132908.ENSPVAP00000011723	0.663	Growth associated protein 43
11	132908.ENSPVAP00000002653	0.659	Dimethylarginine dimethylaminohydrolase 1
12	132908.ENSPVAP00000009907	0.652	Phospholipase A2, group IVA (cytosolic, calcium-dependent)
13	132908.ENSPVAP00000005427	0.636	Bromodomain, testis-specific
14	132908.ENSPVAP00000015138	0.611	Abhydrolase domain containing 17B
15	132908.ENSPVAP00000015691	0.597	Phospholipase A2, group XV
16	132908.ENSPVAP00000004345	0.595	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
17	132908.ENSPVAP00000015465	0.575	acyl-CoA thioesterase 11
18	132908.ENSPVAP00000007771	0.557	Neuroblastoma RAS viral (v-ras) oncogene homolog
19	132908.ENSPVAP00000003178	0.526	Ligand dependent nuclear receptor corepressor
20	132908.ENSPVAP00000009540	0.526	Phospholipase A2, group VI (cytosolic, calcium-independent)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008474	1.000	palmitoyl-(protein) hydrolase activity
GO:0004622	0.997	lysophospholipase activity
GO:0045296	0.991	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0016042	0.990	lipid catabolic process
GO:0036211	0.990	protein modification process
GO:0042157	0.977	lipoprotein metabolic process
GO:0035601	0.938	protein deacylation
GO:1901565	0.936	organonitrogen compound catabolic process
GO:0030163	0.894	protein catabolic process
GO:0009987	0.876	cellular process
GO:0044237	0.792	cellular metabolic process
GO:1901568	0.776	fatty acid derivative metabolic process
GO:0044255	0.352	cellular lipid metabolic process
GO:0065007	0.344	biological regulation
GO:0050789	0.326	regulation of biological process
GO:0050794	0.324	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0012505	0.993	endomembrane system
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005576	0.969	extracellular region
GO:0005829	0.952	cytosol
GO:0031982	0.911	vesicle
GO:0005615	0.818	extracellular space
GO:0043230	0.795	extracellular organelle
GO:1903561	0.738	extracellular vesicle
GO:0016020	0.725	membrane
GO:0070062	0.660	extracellular exosome
GO:0031090	0.538	organelle membrane
GO:0031984	0.498	organelle subcompartment
GO:0005794	0.406	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19233	1.000	H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]
EC:3.1.2.22	1.000	palmitoyl-protein hydrolase.
RHEA:15177	0.997	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	0.997	lysophospholipase.

[back to server]