StarFunc result for job id O95373

User Input

>input (1038 residues)
MDPNTIIEALRGTMDPALREAAERQLNEAHKSLNFVSTLLQITMSEQLDLPVRQAGVIYL
KNMITQYWPDRETAPGDISPYTIPEEDRHCIRENIVEAIIHSPELIRVQLTTCIHHIIKH
DYPSRWTAIVDKIGFYLQSDNSACWLGILLCLYQLVKNYEYKKPEERSPLVAAMQHFLPV
LKDRFIQLLSDQSDQSVLIQKQIFKIFYALVQYTLPLELINQQNLTEWIEILKTVVNRDV
PNETLQVEEDDRPELPWWKCKKWALHILARLFERYGSPGNVSKEYNEFAEVFLKAFAVGV
QQVLLKVLYQYKEKQYMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGIIQDVIFPLMCY
TDADEELWQEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILT
EPNADPRKKDGALHMIGSLAEILLKKKIYKDQMEYMLQNHVFPLFSSELGYMRARACWVL
HYFCEVKFKSDQNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKAKEYITPFIR
PVMQALLHIIRETENDDLTNVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEG
SDDKAVTAMGILNTIDTLLSVVEDHKEITQQLEGICLQVIGTVLQQHVLEFYEEIFSLAH
SLTCQQVSPQMWQLLPLVFEVFQQDGFDYFTDMMPLLHNYVTVDTDTLLSDTKYLEMIYS
MCKKVLTGVAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVEAALERLTREVKTSELRT
MCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLG
LCALIDMEQIPQVLNQVSGQILPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEE
LGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQ
IFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFS
APVVPSSFNFGGPAPGMN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O42480	0.960	0.960	0.000	1038	0.924	0.924	O42480.pdb.gz	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
2	AFDB:O15397	0.910	0.911	2.141E-86	1037	0.640	0.640	O15397.pdb.gz	IPO8_HUMAN Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2
3	AFDB:Q7KIF8	0.925	0.916	2.342E-75	1049	0.546	0.541	Q7KIF8.pdb.gz	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
4	AFDB:O59809	0.784	0.790	4.316E-45	1029	0.280	0.283	O59809.pdb.gz	IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.11 PE=3 SV=1
5	AFDB:F4IRR2	0.806	0.804	1.245E-44	1040	0.292	0.291	F4IRR2.pdb.gz	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
6	AFDB:P46970	0.798	0.791	3.165E-37	1048	0.238	0.236	P46970.pdb.gz	NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMD5 PE=1 SV=2
7	AFDB:Q04175	0.705	0.766	3.820E-34	944	0.213	0.234	Q04175.pdb.gz	SXM1_YEAST Importin beta SMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SXM1 PE=1 SV=1
8	PDB:6n88A	0.368	0.545	5.001E-30	619	0.554	0.929	6n88A.pdb.gz
9	AFDB:Q385Z4	0.802	0.700	1.244E-26	1201	0.205	0.177	Q385Z4.pdb.gz	Q385Z4_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1720 PE=4 SV=1
10	AFDB:Q7SZC2	0.735	0.782	1.010E-22	971	0.178	0.191	Q7SZC2.pdb.gz	XPO2_DANRE Exportin-2 OS=Danio rerio OX=7955 GN=cse1l PE=1 SV=2
11	AFDB:A0A384NKW7	0.708	0.752	1.716E-22	971	0.186	0.199	A0A384NKW7.pdb.gz	A0A384NKW7_HUMAN Exportin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
12	PDB:1wa5C	0.604	0.650	1.431E-19	950	0.165	0.180	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
13	PDB:6n1zA	0.488	0.518	7.727E-18	961	0.135	0.146	6n1zA.pdb.gz
14	PDB:1z3hB	0.631	0.705	2.373E-16	914	0.157	0.178	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding
15	PDB:6fvbA	0.583	0.600	1.775E-15	1001	0.154	0.160	6fvbA.pdb.gz
16	PDB:6ahoA	0.534	0.591	2.487E-13	916	0.132	0.150	6ahoA.pdb.gz
17	PDB:4jlqA	0.425	0.509	4.223E-13	840	0.130	0.161	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	PDB:6xu2A	0.425	0.409	1.218E-12	1091	0.153	0.146	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
19	PDB:3nd2A	0.522	0.613	3.609E-11	861	0.100	0.121	3nd2A.pdb.gz
20	PDB:1qgkA	0.521	0.601	1.157E-10	876	0.113	0.134	1qgkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15397	0.0	1380	1037	0.644	0.644	IPO8_HUMAN Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2
2	O42480	0.0	1965	1038	0.925	0.925	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
3	O95373	0.0	2159	1038	1.000	1.000	IPO7_HUMAN Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1
4	Q7KIF8	0.0	1144	1049	0.540	0.535	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
5	Q86NK4	0.0	1145	1049	0.540	0.535	Q86NK4_DROME GH01576p OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
6	Q95RH0	0.0	763	702	0.365	0.540	Q95RH0_DROME LD30157p OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
7	Q9EPL8	0.0	2149	1038	0.994	0.994	IPO7_MOUSE Importin-7 OS=Mus musculus OX=10090 GN=Ipo7 PE=1 SV=2
8	Q9VSD6	0.0	1148	1049	0.541	0.536	Q9VSD6_DROME D-Importin 7/RanBP7 OS=Drosophila melanogaster OX=7227 GN=msk PE=1 SV=1
9	O59809	7.07e-136	437	1029	0.293	0.295	IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.11 PE=3 SV=1
10	F4IRR2	2.91e-126	412	1040	0.250	0.250	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
11	P46970	6.80e-75	270	1048	0.265	0.262	NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMD5 PE=1 SV=2
12	Q04175	9.55e-53	202	944	0.228	0.251	SXM1_YEAST Importin beta SMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SXM1 PE=1 SV=1
13	Q385Z4	1.24e-26	120	1201	0.106	0.092	Q385Z4_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1720 PE=4 SV=1
14	Q9XZU1	3.05e-19	96.3	975	0.106	0.113	XPO2_DROME Exportin-2 OS=Drosophila melanogaster OX=7227 GN=Cse1 PE=2 SV=2
15	Q9ERK4	1.11e-16	87.8	971	0.117	0.125	XPO2_MOUSE Exportin-2 OS=Mus musculus OX=10090 GN=Cse1l PE=1 SV=1
16	Q5AYN9	1.21e-16	87.8	961	0.137	0.148	Q5AYN9_EMENI Importin N-terminal domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06591 PE=3 SV=1
17	A0A384NKW7	1.68e-16	87.4	971	0.116	0.124	A0A384NKW7_HUMAN Exportin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
18	P55060	1.68e-16	87.4	971	0.116	0.124	XPO2_HUMAN Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3
19	Q7SZC2	7.71e-15	82.0	971	0.114	0.122	XPO2_DANRE Exportin-2 OS=Danio rerio OX=7955 GN=cse1l PE=1 SV=2
20	P33307	4.93e-11	69.3	960	0.049	0.053	CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSE1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08506 Cse1	3.4e-05	34.5	Cse1
2	PF12530 DUF3730	14	16.8	Focadhesin/RST1, DUF3730
3	PF03810 IBN_N	4.3e-19	79.5	Importin-beta N-terminal domain
4	PF07133 Merozoite_SPAM	44	15.5	Merozoite surface protein (SPAM)
5	PF08167 RIX1	85	14.3	rRNA processing/ribosome biogenesis
6	PF05327 RRN3	39	14.2	RNA polymerase I specific transcription initiation factor RRN3
7	PF08389 Xpo1	11	17.5	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021317

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010099	0.899	GTP-binding nuclear protein Ran
2	61853.ENSNLEP00000019614	0.899	GTP-binding nuclear protein Ran
3	61853.ENSNLEP00000009542	0.848	Importin 5
4	61853.ENSNLEP00000001948	0.835	Karyopherin (importin) beta 1
5	61853.ENSNLEP00000000852	0.832	Functions as a component of the nuclear pore complex (NPC).
6	61853.ENSNLEP00000019728	0.824	Nucleoporin 155kDa
7	61853.ENSNLEP00000018615	0.823	Importin 4
8	61853.ENSNLEP00000004509	0.820	Functions as a component of the nuclear pore complex (NPC).
9	61853.ENSNLEP00000017960	0.817	Nucleoporin 160kDa
10	61853.ENSNLEP00000021970	0.806	Importin 9
11	61853.ENSNLEP00000009128	0.802	RAN binding protein 2
12	61853.ENSNLEP00000003002	0.791	DNA-directed RNA polymerase subunit
13	61853.ENSNLEP00000001412	0.776	Nucleoporin 153kDa
14	61853.ENSNLEP00000015422	0.776	Nucleoporin 214kDa
15	61853.ENSNLEP00000002049	0.774	DNA-directed RNA polymerase subunit beta
16	61853.ENSNLEP00000005606	0.758	Transportin 1
17	61853.ENSNLEP00000008014	0.755	WD repeat domain 75
18	61853.ENSNLEP00000024095	0.740	WD repeat domain 3
19	61853.ENSNLEP00000010903	0.715	Transducin (beta)-like 3
20	61853.ENSNLEP00000017555	0.709	Nucleoporin 133kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.882	enzyme binding
GO:1901363	0.626	heterocyclic compound binding
GO:0097159	0.625	organic cyclic compound binding
GO:0003723	0.615	RNA binding
GO:0031267	0.455	small GTPase binding
GO:0042393	0.306	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0046907	0.985	intracellular transport
GO:0034504	0.985	protein localization to nucleus
GO:0072594	0.985	establishment of protein localization to organelle
GO:0071705	0.984	nitrogen compound transport
GO:0071702	0.982	organic substance transport
GO:0051170	0.975	import into nucleus
GO:0006606	0.974	protein import into nucleus
GO:0065007	0.901	biological regulation
GO:0050789	0.834	regulation of biological process
GO:0050794	0.787	regulation of cellular process
GO:0019222	0.399	regulation of metabolic process
GO:0060255	0.370	regulation of macromolecule metabolic process
GO:0031323	0.351	regulation of cellular metabolic process
GO:0080090	0.348	regulation of primary metabolic process
GO:0048519	0.333	negative regulation of biological process
GO:0051171	0.331	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0012505	0.998	endomembrane system
GO:0032991	0.993	protein-containing complex
GO:0016020	0.988	membrane
GO:0140513	0.902	nuclear protein-containing complex
GO:0031967	0.805	organelle envelope
GO:0005635	0.660	nuclear envelope
GO:0005643	0.625	nuclear pore
GO:0043232	0.513	intracellular non-membrane-bounded organelle
GO:0016604	0.316	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]