StarFunc result for job id O95382

User Input

>input (1288 residues)
MAGPCPRSGAERAGSCWQDPLAVALSRGRQLAAPPGRGCARSRPLSVVYVLTREPQPGLE
PREGTEAEPLPLRCLREACAQVPRPRPPPQLRSLPFGTLELGDTAALDAFYNADVVVLEV
SSSLVQPSLFYHLGVRESFSMTNNVLLCSQADLPDLQALREDVFQKNSDCVGSYTLIPYV
VTATGRVLCGDAGLLRGLADGLVQAGVGTEALLTPLVGRLARLLEATPTDSCGYFRETIR
RDIRQARERFSGPQLRQELARLQRRLDSVELLSPDIIMNLLLSYRDVQDYSAIIELVETL
QALPTCDVAEQHNVCFHYTFALNRRNRPGDRAKALSVLLPLVQLEGSVAPDLYCMCGRIY
KDMFFSSGFQDAGHREQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSKELRLIGM
KLGCLLARKGCVEKMQYYWDVGFYLGAQILANDPTQVVLAAEQLYKLNAPIWYLVSVMET
FLLYQHFRPTPEPPGGPPRRAHFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAK
LEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQ
LCFPSVGHCQWFCGLIQAWVTNPDSTAPAEEAEGAGEMLEFDYEYTETGERLVLGKGTYG
VVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHRRLRHKNIVRYLGSASQGGYLKI
FMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLGYLHDNHIVHRDIKGDNVLIN
TFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVI
EMATGRPPFHELGSPQAAMFQVGMYKVHPPMPSSLSAEAQAFLLRTFEPDPRLRASAQTL
LGDPFLQPGKRSRSPSSPRHAPRPSDAPSASPTPSANSTTQSQTFPCPQAPSQHPPSPPK
RCLSYGGTSQLRVPEEPAAEEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLH
QEQKQEQGARLGRNHVEELLRCLGAHIHTPNRRQLAQELRALQGRLRAQGLGPALLHRPL
FAFPDAVKQILRKRQIRPHWMFVLDSLLSRAVRAALGVLGPEVEKEAVSPRSEELSNEGD
SQQSPGQQSPLPVEPEQGPAPLMVQLSLLRAETDRLREILAGKEREYQALVQRALQRLNE
EARTYVLAPEPPTALSTDQGLVQWLQELNVDSGTIQMLLNHSFTLHTLLTYATRDDLIYT
RIRGGMVCRIWRAILAQRAGSTPVTSGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZH6	0.566	0.534	0.000	1379	0.469	0.438	D3ZZH6.pdb.gz	D3ZZH6_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
2	AFDB:O95382	1.000	1.000	0.000	1288	1.000	1.000	O95382.pdb.gz	M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 PE=1 SV=3
3	AFDB:Q9WTR2	0.750	0.749	0.000	1291	0.871	0.869	Q9WTR2.pdb.gz	M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus OX=10090 GN=Map3k6 PE=1 SV=4
4	AFDB:Q9VDS9	0.558	0.531	2.825E-89	1363	0.367	0.347	Q9VDS9.pdb.gz	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3
5	AFDB:Q21029	0.446	0.389	6.451E-82	1498	0.360	0.310	Q21029.pdb.gz	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
6	AFDB:Q54R82	0.199	0.270	1.143E-21	942	0.103	0.141	Q54R82.pdb.gz	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
7	AFDB:O22040	0.198	0.369	3.534E-20	666	0.120	0.233	O22040.pdb.gz	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
8	AFDB:O14299	0.194	0.179	1.109E-19	1401	0.139	0.128	O14299.pdb.gz	WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wis4 PE=3 SV=1
9	AFDB:Q40541	0.197	0.355	2.094E-19	690	0.113	0.212	Q40541.pdb.gz	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
10	AFDB:Q9CAD5	0.188	0.272	2.480E-19	883	0.098	0.143	Q9CAD5.pdb.gz	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
11	PDB:4eomC	0.176	0.755	7.002E-15	276	0.071	0.330	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:4yc3A	0.185	0.751	2.293E-14	295	0.064	0.278	4yc3A.pdb.gz
13	PDB:1unlA	0.184	0.757	3.977E-14	292	0.061	0.267	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
14	PDB:4krcA	0.182	0.738	5.127E-14	297	0.069	0.300	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
15	PDB:6s9wA	0.188	0.506	9.278E-14	411	0.071	0.221	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
16	PDB:3eqdA	0.180	0.684	1.010E-13	315	0.064	0.260	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
17	PDB:5u6yA	0.181	0.488	1.906E-13	459	0.057	0.159	5u6yA.pdb.gz
18	PDB:4zhxA	0.188	0.565	2.258E-13	409	0.055	0.174	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:5dykA	0.182	0.285	3.306E-13	809	0.064	0.103	5dykA.pdb.gz
20	PDB:5ufuA	0.177	0.592	4.263E-13	369	0.056	0.195	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A280	0.0	1142	1373	0.475	0.446	A0A8I6A280_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=1
2	A0A8I6AEL0	0.0	1153	1381	0.478	0.446	A0A8I6AEL0_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=1
3	D3ZW27	0.0	1079	1365	0.463	0.437	D3ZW27_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
4	D3ZZH6	0.0	1156	1381	0.478	0.446	D3ZZH6_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
5	O35099	0.0	1156	1380	0.478	0.446	M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus OX=10090 GN=Map3k5 PE=1 SV=3
6	O95382	0.0	2629	1288	1.000	1.000	M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 PE=1 SV=3
7	Q21029	0.0	640	1498	0.293	0.252	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
8	Q7KSB7	0.0	716	1196	0.297	0.320	Q7KSB7_DROME Apoptotic signal-regulating kinase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=1
9	Q8I6M5	0.0	761	1367	0.328	0.309	Q8I6M5_DROME DASK1 OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=2 SV=1
10	Q99683	0.0	1158	1374	0.478	0.448	M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP3K5 PE=1 SV=1
11	Q9VDS9	0.0	762	1363	0.328	0.310	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3
12	Q9WTR2	0.0	2215	1291	0.873	0.871	M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus OX=10090 GN=Map3k6 PE=1 SV=4
13	Q24458	1.98e-162	502	650	0.208	0.412	Q24458_DROME Protein kinase OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=2 SV=1
14	Q40541	4.55e-59	219	690	0.093	0.174	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
15	O22040	3.53e-57	213	666	0.092	0.177	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
16	Q54R82	1.66e-56	215	942	0.089	0.122	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
17	Q9FZ36	7.71e-56	208	651	0.089	0.175	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
18	O22042	9.63e-55	205	651	0.091	0.180	M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1
19	Q9LJD8	2.19e-48	191	1368	0.085	0.080	M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=M3KE1 PE=1 SV=1
20	A0A078CGE6	5.81e-48	190	1299	0.085	0.084	M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus OX=3708 GN=M3KE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19039 ASK_PH	2.1e-19	81.1	ASK kinase PH domain
2	PF20309 DRHyd-ASK	2.6e-08	45.0	Deoxyribohydrolase (DRHyd) domain of the ASK signalosome
3	PF20302 HisK-N-like	1.6e-30	117.5	HisK-N-like globin domain of the ASK signalosome
4	PF13281 MAP3K_TRAF_bd	2.1e-148	506.0	MAP3K TRAFs-binding domain
5	PF00069 Pkinase	5.8e-58	207.9	Protein kinase domain
6	PF17667 Pkinase_fungal	32	14.8	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	7.8e-35	132.0	Protein tyrosine and serine/threonine kinase
8	PF13543 SAM_KSR1	3.4e+02	12.8	SAM like domain present in kinase suppressor RAS 1
9	PF20308 TPR-S	8.8e-19	79.3	Tetratricopeptide Repeats-Sensor
10	PF10707 YrbL-PhoP_reg	93	14.1	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419591

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351908	0.971	Mitogen-activated protein kinase kinase kinase 5
2	9606.ENSP00000468348	0.917	Dual specificity mitogen-activated protein kinase kinase 6
3	9606.ENSP00000345083	0.855	Dual specificity mitogen-activated protein kinase kinase 3
4	9606.ENSP00000451828	0.587	RAC-alpha serine/threonine-protein kinase
5	9606.ENSP00000263826	0.547	RAC-gamma serine/threonine-protein kinase
6	9606.ENSP00000375892	0.547	RAC-beta serine/threonine-protein kinase
7	9606.ENSP00000311368	0.539	DNA polymerase delta subunit 4
8	9606.ENSP00000480527	0.539	annotation not available
9	9606.ENSP00000262366	0.518	Zinc finger protein GLIS2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035639	0.999	purine ribonucleoside triphosphate binding
GO:0004709	0.999	MAP kinase kinase kinase activity
GO:0032555	0.999	purine ribonucleotide binding
GO:0005524	0.986	ATP binding
GO:0000287	0.973	magnesium ion binding
GO:0019899	0.797	enzyme binding
GO:0019900	0.572	kinase binding
GO:0019901	0.507	protein kinase binding
GO:0042802	0.304	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.991	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0044237	0.989	cellular metabolic process
GO:0051716	0.982	cellular response to stimulus
GO:0007154	0.973	cell communication
GO:0023052	0.968	signaling
GO:0071704	0.962	organic substance metabolic process
GO:0006807	0.962	nitrogen compound metabolic process
GO:0007165	0.957	signal transduction
GO:0044238	0.951	primary metabolic process
GO:0006796	0.950	phosphate-containing compound metabolic process
GO:1901564	0.890	organonitrogen compound metabolic process
GO:0016310	0.865	phosphorylation
GO:0006468	0.863	protein phosphorylation
GO:0048518	0.728	positive regulation of biological process
GO:0048522	0.647	positive regulation of cellular process
GO:0048583	0.601	regulation of response to stimulus
GO:0023051	0.488	regulation of signaling
GO:0010646	0.488	regulation of cell communication
GO:0009966	0.460	regulation of signal transduction
GO:0019222	0.361	regulation of metabolic process
GO:0060255	0.340	regulation of macromolecule metabolic process
GO:0080090	0.334	regulation of primary metabolic process
GO:0031323	0.305	regulation of cellular metabolic process
GO:0009893	0.300	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.962	membrane
GO:0043229	0.959	intracellular organelle
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0071944	0.868	cell periphery
GO:0005886	0.857	plasma membrane
GO:0005634	0.443	nucleus
GO:0032991	0.385	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.25	0.999	mitogen-activated protein kinase kinase kinase.

[back to server]