StarFunc result for job id O95388

User Input

>input (367 residues)
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95388	1.000	1.000	2.055E-68	367	1.000	1.000	O95388.pdb.gz	CCN4_HUMAN CCN family member 4 OS=Homo sapiens OX=9606 GN=CCN4 PE=1 SV=1
2	AFDB:O54775	0.479	0.479	2.666E-59	367	0.837	0.837	O54775.pdb.gz	CCN4_MOUSE CCN family member 4 OS=Mus musculus OX=10090 GN=Ccn4 PE=2 SV=1
3	AFDB:A0A384NYW3	0.517	0.533	4.722E-38	354	0.409	0.424	A0A384NYW3.pdb.gz	A0A384NYW3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:D0E2W2	0.525	0.561	2.619E-37	338	0.379	0.411	D0E2W2.pdb.gz	D0E2W2_DANRE Cellular communication network factor 6 OS=Danio rerio OX=7955 GN=si:dkey-119m7.6 PE=2 SV=1
5	AFDB:P29279	0.445	0.465	3.075E-37	349	0.401	0.421	P29279.pdb.gz	CCN2_HUMAN CCN family member 2 OS=Homo sapiens OX=9606 GN=CCN2 PE=1 SV=2
6	AFDB:Q5RI33	0.436	0.461	4.018E-37	345	0.403	0.429	Q5RI33.pdb.gz	Q5RI33_DANRE Cellular communication network factor 2a (Fragment) OS=Danio rerio OX=7955 GN=ctgf PE=2 SV=1
7	AFDB:Q98TQ8	0.498	0.527	1.898E-36	344	0.390	0.416	Q98TQ8.pdb.gz	Q98TQ8_CHICK Cellular communication network factor 2 OS=Gallus gallus OX=9031 GN=CCN2 PE=2 SV=1
8	AFDB:A0A024R9J4	0.423	0.434	1.375E-35	357	0.349	0.359	A0A024R9J4.pdb.gz
9	AFDB:Q64299	0.370	0.382	3.070E-35	354	0.371	0.384	Q64299.pdb.gz	CCN3_MOUSE CCN family member 3 OS=Mus musculus OX=10090 GN=Ccn3 PE=1 SV=1
10	AFDB:O00622	0.388	0.375	3.417E-35	381	0.379	0.365	O00622.pdb.gz	CCN1_HUMAN CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1
11	PDB:2k8pA	0.162	0.280	2.227E-3	189	0.076	0.148	2k8pA.pdb.gz
12	PDB:4a5wB	0.099	0.045	4.968E-2	871	0.046	0.020	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
13	PDB:5hk5F	0.142	0.341	9.443E-2	129	0.046	0.132	5hk5F.pdb.gz
14	PDB:2n6fA	0.128	0.285	9.962E-2	136	0.052	0.140	2n6fA.pdb.gz
15	PDB:3t5oA	0.096	0.043	9.962E-2	871	0.060	0.025	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
16	PDB:1wq8A	0.118	0.333	1.449E-1	100	0.027	0.100	1wq8A.pdb.gz
17	PDB:4my2A	0.098	0.077	1.894E-1	474	0.044	0.034	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
18	PDB:4aq1A	0.067	0.038	1.998E-1	721	0.033	0.017	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
19	PDB:4e0sB	0.104	0.045	1.998E-1	898	0.054	0.022	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
20	PDB:5ffoG	0.148	0.177	1.998E-1	297	0.038	0.047	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54775	0.0	617	367	0.837	0.837	CCN4_MOUSE CCN family member 4 OS=Mus musculus OX=10090 GN=Ccn4 PE=2 SV=1
2	O95388	0.0	751	367	1.000	1.000	CCN4_HUMAN CCN family member 4 OS=Homo sapiens OX=9606 GN=CCN4 PE=1 SV=1
3	Q99PP0	0.0	613	367	0.831	0.831	CCN4_RAT CCN family member 4 OS=Rattus norvegicus OX=10116 GN=Ccn4 PE=2 SV=1
4	Q5RI33	9.65e-100	301	345	0.403	0.429	Q5RI33_DANRE Cellular communication network factor 2a (Fragment) OS=Danio rerio OX=7955 GN=ctgf PE=2 SV=1
5	A0A384NYW3	1.82e-99	300	354	0.414	0.429	A0A384NYW3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
6	O95389	1.82e-99	300	354	0.414	0.429	CCN6_HUMAN Cellular communication network factor 6 OS=Homo sapiens OX=9606 GN=CCN6 PE=1 SV=1
7	P29279	8.10e-99	298	349	0.431	0.453	CCN2_HUMAN CCN family member 2 OS=Homo sapiens OX=9606 GN=CCN2 PE=1 SV=2
8	Q98TQ8	2.35e-97	295	344	0.414	0.442	Q98TQ8_CHICK Cellular communication network factor 2 OS=Gallus gallus OX=9031 GN=CCN2 PE=2 SV=1
9	Q9R1E9	3.14e-95	289	347	0.392	0.415	CCN2_RAT CCN family member 2 OS=Rattus norvegicus OX=10116 GN=Ccn2 PE=2 SV=1
10	P29268	1.84e-94	287	348	0.390	0.411	CCN2_MOUSE CCN family member 2 OS=Mus musculus OX=10090 GN=Ccn2 PE=1 SV=3
11	D0E2W2	1.01e-90	277	338	0.373	0.405	D0E2W2_DANRE Cellular communication network factor 6 OS=Danio rerio OX=7955 GN=si:dkey-119m7.6 PE=2 SV=1
12	P48745	7.25e-80	250	357	0.360	0.370	CCN3_HUMAN CCN family member 3 OS=Homo sapiens OX=9606 GN=CCN3 PE=1 SV=1
13	Q64299	1.15e-78	247	354	0.376	0.390	CCN3_MOUSE CCN family member 3 OS=Mus musculus OX=10090 GN=Ccn3 PE=1 SV=1
14	Q9ES72	2.94e-78	247	379	0.392	0.380	CCN1_RAT CCN family member 1 OS=Rattus norvegicus OX=10116 GN=Ccn1 PE=2 SV=1
15	F1QL10	3.93e-78	246	369	0.371	0.369	F1QL10_DANRE Cellular communication network factor 1 OS=Danio rerio OX=7955 GN=cyr61 PE=3 SV=1
16	O00622	1.42e-77	245	381	0.406	0.391	CCN1_HUMAN CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1
17	P18406	1.63e-77	245	379	0.376	0.364	CCN1_MOUSE CCN family member 1 OS=Mus musculus OX=10090 GN=Ccn1 PE=1 SV=1
18	Q9QZQ5	3.17e-77	243	351	0.360	0.376	CCN3_RAT CCN family member 3 OS=Rattus norvegicus OX=10116 GN=Ccn3 PE=1 SV=1
19	Q9Z0G4	7.09e-48	164	251	0.248	0.363	CCN5_MOUSE CCN family member 5 OS=Mus musculus OX=10090 GN=Ccn5 PE=2 SV=1
20	Q9JHC6	2.95e-43	152	250	0.221	0.324	CCN5_RAT CCN family member 5 OS=Rattus norvegicus OX=10116 GN=Ccn5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	6.7e-05	34.5	Cystine-knot domain
2	PF00219 IGFBP	1.3e-06	40.2	Insulin-like growth factor binding protein
3	PF19035 TSP1_CCN	5.6e-13	60.3	CCN3 Nov like TSP1 domain
4	PF00090 TSP_1	0.18	23.3	Thrombospondin type 1 domain
5	PF00093 VWC	4.2e-05	35.1	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250160

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000052754	0.953	Decorin
2	9606.ENSP00000404854	0.772	Protein NDRG1
3	9606.ENSP00000293549	0.752	Proto-oncogene Wnt-1
4	9606.ENSP00000452786	0.709	Integrin beta-3
5	9606.ENSP00000327336	0.707	Biglycan
6	9606.ENSP00000344456	0.668	Catenin beta-1
7	9606.ENSP00000265441	0.604	Protein Wnt-2
8	9606.ENSP00000264634	0.583	Protein Wnt-5a
9	9606.ENSP00000369071	0.551	Periostin
10	9606.ENSP00000280527	0.545	Cysteine-rich motor neuron 1 protein
11	9606.ENSP00000284523	0.535	Protein Wnt-3a
12	9606.ENSP00000225964	0.526	Collagen alpha-1(I) chain
13	9606.ENSP00000295113	0.526	Secreted frizzled-related protein 3
14	9606.ENSP00000346839	0.504	Fibronectin type III domain containing
15	9606.ENSP00000302625	0.503	Axin-2
16	9606.ENSP00000297268	0.502	Collagen alpha-2(I) chain
17	9606.ENSP00000363081	0.502	Dickkopf-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.488	signaling receptor binding
GO:0140677	0.338	molecular function activator activity
GO:0030545	0.304	signaling receptor regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0051239	0.988	regulation of multicellular organismal process
GO:0048522	0.985	positive regulation of cellular process
GO:0048856	0.979	anatomical structure development
GO:0050896	0.960	response to stimulus
GO:0019222	0.957	regulation of metabolic process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0032501	0.942	multicellular organismal process
GO:0050793	0.911	regulation of developmental process
GO:0045595	0.883	regulation of cell differentiation
GO:0048583	0.876	regulation of response to stimulus
GO:0051094	0.866	positive regulation of developmental process
GO:0048519	0.853	negative regulation of biological process
GO:0045597	0.843	positive regulation of cell differentiation
GO:0007275	0.833	multicellular organism development
GO:0048523	0.828	negative regulation of cellular process
GO:0051716	0.814	cellular response to stimulus
GO:0042127	0.757	regulation of cell population proliferation
GO:0045667	0.752	regulation of osteoblast differentiation
GO:0007154	0.727	cell communication
GO:0023052	0.723	signaling
GO:2000026	0.723	regulation of multicellular organismal development
GO:0010468	0.710	regulation of gene expression
GO:0051240	0.688	positive regulation of multicellular organismal process
GO:0048584	0.666	positive regulation of response to stimulus
GO:0007267	0.633	cell-cell signaling
GO:0048731	0.628	system development
GO:0007165	0.605	signal transduction
GO:0031323	0.603	regulation of cellular metabolic process
GO:0080134	0.552	regulation of response to stress
GO:0048869	0.520	cellular developmental process
GO:0030154	0.508	cell differentiation
GO:0048513	0.500	animal organ development
GO:0010646	0.494	regulation of cell communication
GO:0023051	0.493	regulation of signaling
GO:0009893	0.490	positive regulation of metabolic process
GO:0080090	0.478	regulation of primary metabolic process
GO:0051171	0.478	regulation of nitrogen compound metabolic process
GO:0010604	0.470	positive regulation of macromolecule metabolic process
GO:0009966	0.455	regulation of signal transduction
GO:0032101	0.409	regulation of response to external stimulus
GO:0009889	0.391	regulation of biosynthetic process
GO:0051093	0.364	negative regulation of developmental process
GO:0031326	0.335	regulation of cellular biosynthetic process
GO:0040012	0.332	regulation of locomotion
GO:0031347	0.316	regulation of defense response
GO:0051128	0.314	regulation of cellular component organization
GO:0009653	0.305	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0043231	0.856	intracellular membrane-bounded organelle
GO:0005829	0.724	cytosol
GO:0071944	0.479	cell periphery
GO:0070013	0.420	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]