StarFunc result for job id O95390

User Input

>input (407 residues)
MVLAAPLLLGFLLLALELRPRGEAAEGPAAAAAAAAAAAAAGVGGERSSRPAPSVAPEPD
GCPVCVWRQHSRELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQ
GDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQL
WVYLRPVPRPATVYLQILRLKPLTGEGTAGGGGGGRRHIRIRSLKIELHSRSGHWQSIDF
KQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENTKRSRRNL
GLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQ
QANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RB20	0.729	0.729	2.171E-69	407	1.000	1.000	A0A024RB20.pdb.gz
2	AFDB:Q8JFP9	0.800	0.834	3.887E-57	390	0.695	0.726	Q8JFP9.pdb.gz	Q8JFP9_DANRE Gdf11-like OS=Danio rerio OX=7955 GN=gdf11 PE=2 SV=2
3	AFDB:O08689	0.526	0.562	1.218E-49	376	0.575	0.622	O08689.pdb.gz	GDF8_MOUSE Growth/differentiation factor 8 OS=Mus musculus OX=10090 GN=Mstn PE=1 SV=1
4	AFDB:O42222	0.442	0.480	6.909E-48	374	0.577	0.628	O42222.pdb.gz	GDF8_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=mstnb PE=2 SV=2
5	AFDB:Q5I3Q2	0.420	0.453	9.699E-45	376	0.597	0.646	Q5I3Q2.pdb.gz	GDF8_EPICO Growth/differentiation factor 8 OS=Epinephelus coioides OX=94232 GN=gdf-8 PE=1 SV=1
6	AFDB:B3DIZ5	0.380	0.420	1.991E-44	366	0.538	0.598	B3DIZ5.pdb.gz
7	PDB:5ntuA	0.448	0.560	2.882E-42	308	0.516	0.682	5ntuA.pdb.gz
8	PDB:5nxsA	0.520	0.688	9.876E-36	290	0.496	0.697	5nxsA.pdb.gz
9	PDB:6umxA	0.410	0.560	1.174E-32	279	0.464	0.677	6umxA.pdb.gz
10	PDB:5nxsB	0.419	0.628	1.684E-28	251	0.430	0.697	5nxsB.pdb.gz
11	AFDB:Q9V4F4	0.538	0.390	1.393E-24	598	0.258	0.176	Q9V4F4.pdb.gz	Q9V4F4_DROME LD29161p OS=Drosophila melanogaster OX=7227 GN=myo PE=2 SV=1
12	AFDB:Q91350	0.323	0.350	8.414E-20	370	0.256	0.281	Q91350.pdb.gz	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
13	AFDB:P27093	0.297	0.307	5.222E-19	391	0.263	0.274	P27093.pdb.gz	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
14	AFDB:P92172	0.328	0.365	1.579E-18	350	0.226	0.263	P92172.pdb.gz	DAF7_CAEEL Dauer larva development regulatory growth factor daf-7 OS=Caenorhabditis elegans OX=6239 GN=daf-7 PE=1 SV=1
15	PDB:5hlyA	0.438	0.554	3.413E-18	299	0.211	0.288	5hlyA.pdb.gz
16	PDB:5vqfB	0.244	0.301	1.161E-14	320	0.194	0.247	5vqfB.pdb.gz
17	PDB:3rjrC	0.239	0.278	6.450E-14	343	0.201	0.239	3rjrC.pdb.gz
18	PDB:5ffoG	0.241	0.316	2.718E-13	297	0.187	0.256	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
19	PDB:7y1rB	0.228	0.286	1.210E-12	308	0.192	0.253	7y1rB.pdb.gz
20	PDB:6q2sA	0.135	0.492	1.131E-2	98	0.052	0.214	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YI30	0.0	793	380	0.931	0.997	H0YI30_HUMAN Growth differentiation factor 11 (Fragment) OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
2	O95390	0.0	845	407	1.000	1.000	GDF11_HUMAN Growth/differentiation factor 11 OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
3	Q8JFP9	0.0	599	390	0.681	0.710	Q8JFP9_DANRE Gdf11-like OS=Danio rerio OX=7955 GN=gdf11 PE=2 SV=2
4	Q9Z1W4	0.0	833	405	0.990	0.995	GDF11_MOUSE Growth/differentiation factor 11 OS=Mus musculus OX=10090 GN=Gdf11 PE=1 SV=1
5	Q9Z217	0.0	835	405	0.993	0.998	GDF11_RAT Growth/differentiation factor 11 OS=Rattus norvegicus OX=10116 GN=Gdf11 PE=2 SV=2
6	O42220	7.04e-178	502	375	0.587	0.637	GDF8_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
7	Q06BS3	7.04e-178	502	375	0.587	0.637	Q06BS3_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=GDF8 PE=2 SV=1
8	O42221	1.63e-177	501	375	0.577	0.627	GDF8_MELGA Growth/differentiation factor 8 OS=Meleagris gallopavo OX=9103 GN=MSTN PE=2 SV=2
9	D1LWV1	1.04e-176	499	375	0.585	0.635	D1LWV1_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
10	D1LWV2	1.50e-176	498	375	0.575	0.624	D1LWV2_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
11	Q5I3Q2	3.86e-174	493	376	0.568	0.614	GDF8_EPICO Growth/differentiation factor 8 OS=Epinephelus coioides OX=94232 GN=gdf-8 PE=1 SV=1
12	O14793	7.25e-174	492	375	0.558	0.605	GDF8_HUMAN Growth/differentiation factor 8 OS=Homo sapiens OX=9606 GN=MSTN PE=1 SV=1
13	O08689	1.01e-172	489	376	0.555	0.601	GDF8_MOUSE Growth/differentiation factor 8 OS=Mus musculus OX=10090 GN=Mstn PE=1 SV=1
14	O42222	3.91e-172	487	374	0.575	0.626	GDF8_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=mstnb PE=2 SV=2
15	O35312	8.54e-172	486	376	0.553	0.598	GDF8_RAT Growth/differentiation factor 8 OS=Rattus norvegicus OX=10116 GN=Mstn PE=2 SV=1
16	Q9GM97	1.66e-171	486	375	0.550	0.597	GDF8_HORSE Growth/differentiation factor 8 OS=Equus caballus OX=9796 GN=MSTN PE=2 SV=1
17	O18836	8.52e-169	479	375	0.550	0.597	GDF8_BOVIN Growth/differentiation factor 8 OS=Bos taurus OX=9913 GN=MSTN PE=1 SV=2
18	Q68IN2	1.46e-156	447	366	0.531	0.590	Q68IN2_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=gdf8l PE=2 SV=1
19	Q91350	8.94e-36	137	370	0.258	0.284	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
20	Q9V4F4	4.17e-33	132	598	0.157	0.107	Q9V4F4_DROME LD29161p OS=Drosophila melanogaster OX=7227 GN=myo PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.3e-20	85.7	TGF-beta propeptide
2	PF00019 TGF_beta	2.5e-26	103.9	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257868

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340361	0.999	Activin receptor type-2B
2	9606.ENSP00000364133	0.989	TGF-beta receptor type-1
3	9606.ENSP00000241416	0.969	Activin receptor type-2A
4	9606.ENSP00000256759	0.952	Follistatin
5	9606.ENSP00000362777	0.903	Protein atonal homolog 7
6	9606.ENSP00000442656	0.897	Activin receptor type-1B
7	9606.ENSP00000311184	0.871	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2
8	9606.ENSP00000324763	0.815	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1
9	9606.ENSP00000286574	0.812	Wnt inhibitory factor 1
10	9606.ENSP00000262160	0.790	Mothers against decapentaplegic homolog 2
11	9606.ENSP00000243349	0.784	Activin receptor type-1C
12	9606.ENSP00000252971	0.725	Motor neuron and pancreas homeobox protein 1
13	9606.ENSP00000341551	0.710	Mothers against decapentaplegic homolog 4
14	9606.ENSP00000446280	0.696	Proprotein convertase subtilisin/kexin type 5
15	9606.ENSP00000166139	0.662	Follistatin-related protein 3
16	9606.ENSP00000363642	0.654	Ribosome biogenesis protein BMS1 homolog
17	9606.ENSP00000332973	0.642	Mothers against decapentaplegic homolog 3
18	9606.ENSP00000305714	0.623	Bone morphogenetic protein 1
19	9606.ENSP00000417898	0.598	Glycodelin
20	9606.ENSP00000441954	0.584	Mothers against decapentaplegic homolog 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.995	signaling receptor binding
GO:0098772	0.710	molecular function regulator activity
GO:0140677	0.699	molecular function activator activity
GO:0030545	0.694	signaling receptor regulator activity
GO:0030546	0.666	signaling receptor activator activity
GO:0048018	0.664	receptor ligand activity
GO:0042802	0.539	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.992	anatomical structure development
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.981	response to stimulus
GO:0032501	0.978	multicellular organismal process
GO:0023052	0.964	signaling
GO:0007154	0.937	cell communication
GO:0007275	0.931	multicellular organism development
GO:0007178	0.884	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048731	0.858	system development
GO:0045596	0.803	negative regulation of cell differentiation
GO:0009888	0.777	tissue development
GO:0048518	0.745	positive regulation of biological process
GO:0060395	0.713	SMAD protein signal transduction
GO:0019222	0.678	regulation of metabolic process
GO:0045664	0.677	regulation of neuron differentiation
GO:0007399	0.666	nervous system development
GO:0048522	0.646	positive regulation of cellular process
GO:0048513	0.609	animal organ development
GO:0031323	0.481	regulation of cellular metabolic process
GO:0060255	0.478	regulation of macromolecule metabolic process
GO:0080090	0.473	regulation of primary metabolic process
GO:0051171	0.473	regulation of nitrogen compound metabolic process
GO:0010468	0.401	regulation of gene expression
GO:0019219	0.355	regulation of nucleobase-containing compound metabolic process
GO:0051239	0.344	regulation of multicellular organismal process
GO:0030154	0.312	cell differentiation
GO:0010604	0.306	positive regulation of macromolecule metabolic process
GO:0023051	0.302	regulation of signaling
GO:0009719	0.301	response to endogenous stimulus
GO:0010646	0.301	regulation of cell communication
GO:0048583	0.300	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.996	nucleus
GO:0005654	0.986	nucleoplasm
GO:0005576	0.941	extracellular region
GO:0032991	0.933	protein-containing complex
GO:0005615	0.530	extracellular space
GO:0005737	0.522	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]