StarFunc result for job id O95395

User Input

>input (438 residues)
MVQWKRLCQLHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRNILYNFL
KLPAKRSINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFI
QFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAII
SCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMV
QALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIV
ASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSI
ARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNA
LQCLEEYLRYKAIYGTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95395	1.000	1.000	6.054E-89	438	1.000	1.000	O95395.pdb.gz	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
2	AFDB:Q5JCT0	0.955	0.957	5.598E-75	437	0.769	0.771	Q5JCT0.pdb.gz	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
3	AFDB:Q09324	0.843	0.862	9.043E-55	428	0.482	0.493	Q09324.pdb.gz	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
4	AFDB:Q02742	0.846	0.865	9.563E-55	428	0.493	0.505	Q02742.pdb.gz	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
5	PDB:2gamC	0.824	0.962	6.987E-51	374	0.466	0.545	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
6	AFDB:E9Q649	0.788	0.759	2.401E-45	455	0.400	0.385	E9Q649.pdb.gz	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
7	AFDB:Q9P109	0.793	0.768	9.189E-45	453	0.400	0.386	Q9P109.pdb.gz	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
8	AFDB:Q6T5D9	0.663	0.724	1.954E-41	400	0.374	0.410	Q6T5D9.pdb.gz	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
9	AFDB:Q6T5E1	0.700	0.764	1.547E-40	400	0.358	0.393	Q6T5E1.pdb.gz	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
10	AFDB:Q8N0V5	0.697	0.757	2.559E-40	402	0.340	0.371	Q8N0V5.pdb.gz	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
11	AFDB:P97402	0.687	0.749	1.916E-39	401	0.352	0.384	P97402.pdb.gz	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
12	PDB:6fxrA	0.234	0.156	3.040E-5	700	0.062	0.039	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:1jv1A	0.236	0.214	8.319E-5	490	0.078	0.069	1jv1A.pdb.gz	Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.
14	PDB:7x8kB	0.221	0.256	1.820E-4	367	0.057	0.068	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
15	PDB:3r2wC	0.234	0.229	2.546E-4	450	0.068	0.067	3r2wC.pdb.gz
16	PDB:6r8uA	0.220	0.225	3.367E-4	425	0.059	0.061	6r8uA.pdb.gz	The allosteric control mechanism of bacterial glycogen biosynthesis disclosed by cryoEM
17	PDB:7jhiC	0.365	0.464	3.982E-4	331	0.075	0.100	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
18	PDB:5l6vI	0.176	0.189	4.211E-4	400	0.057	0.062	5l6vI.pdb.gz	Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
19	PDB:4hg6A	0.198	0.122	9.215E-4	747	0.080	0.047	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
20	PDB:2icyB	0.223	0.213	1.363E-3	463	0.068	0.065	2icyB.pdb.gz	Structure and Dynamics of UDP-Glucose Pyrophosphorylase from Arabidopsis thaliana with Bound UDP-Glucose and UTP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95395	0.0	922	438	1.000	1.000	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
2	Q5JCT0	0.0	729	437	0.769	0.771	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
3	Q8CH87	0.0	735	437	0.779	0.780	GCNT3_RAT Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1
4	Q02742	9.96e-155	446	428	0.479	0.491	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
5	Q64165	1.11e-149	434	428	0.461	0.472	Q64165_RAT Glucosaminyl (N-acetyl) transferase 1 OS=Rattus norvegicus OX=10116 GN=Gcnt1 PE=4 SV=1
6	Q09324	1.93e-149	433	428	0.463	0.474	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
7	Q9P109	2.88e-109	332	453	0.404	0.391	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
8	E9Q649	1.57e-107	327	455	0.386	0.371	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
9	Q6T5D9	6.59e-105	318	400	0.354	0.388	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
10	Q6T5E1	3.50e-103	314	400	0.347	0.380	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
11	P97402	1.20e-101	310	401	0.349	0.382	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
12	Q6T5E0	6.59e-99	303	400	0.342	0.375	Q6T5E0_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=4 SV=1
13	Q8N0V5	8.91e-92	285	402	0.331	0.361	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
14	Q7KVA1	3.33e-18	89.7	876	0.185	0.092	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
15	Q9EPL0	5.24e-14	76.6	865	0.132	0.067	XYLT2_MOUSE Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
16	Q9H1B5	9.32e-14	75.9	865	0.135	0.068	XYLT2_HUMAN Xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=XYLT2 PE=1 SV=2
17	D3J0E7	4.63e-11	67.4	919	0.107	0.051	D3J0E7_DANRE protein xylosyltransferase OS=Danio rerio OX=7955 GN=xylt1 PE=2 SV=1
18	Q9LE60	7.73e-11	65.9	424	0.112	0.116	Q9LE60_ARATH AT3g15350/K7L4_15 OS=Arabidopsis thaliana OX=3702 GN=At3g15350 PE=1 SV=1
19	Q811B1	4.61e-10	64.3	953	0.078	0.036	XYLT1_MOUSE Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1
20	F4JIW2	8.19e-10	62.8	421	0.112	0.116	F4JIW2_ARATH Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g27480 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02485 Branch	4.8e-66	234.3	Core-2/I-Branching enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484640	0.973	Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
2	9606.ENSP00000389176	0.965	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
3	9606.ENSP00000304364	0.957	C1GALT1-specific chaperone 1
4	9606.ENSP00000321874	0.955	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
5	9606.ENSP00000428540	0.955	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
6	9606.ENSP00000414350	0.943	Mucin-20
7	9606.ENSP00000406861	0.936	Mucin-6
8	9606.ENSP00000485659	0.934	Mucin-5AC
9	9606.ENSP00000436812	0.932	Mucin-5B
10	9606.ENSP00000417498	0.931	Mucin-4
11	9606.ENSP00000485028	0.931	Mucin-13
12	9606.ENSP00000377257	0.930	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
13	9606.ENSP00000381008	0.930	Mucin-16
14	9606.ENSP00000369055	0.928	Beta-1,4-galactosyltransferase 1
15	9606.ENSP00000416753	0.928	Mucin-15
16	9606.ENSP00000302716	0.927	Mucin-17
17	9606.ENSP00000484824	0.925	Mucin-1
18	9606.ENSP00000441929	0.921	Mucin-12
19	9606.ENSP00000407422	0.919	Mucin-7
20	9606.ENSP00000368771	0.918	Mucin-3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140103	1.000	catalytic activity, acting on a glycoprotein
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0005488	0.832	binding
GO:0003829	0.796	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity
GO:0005515	0.784	protein binding
GO:0008109	0.548	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0009100	0.981	glycoprotein metabolic process
GO:0070085	0.979	glycosylation
GO:0006493	0.968	protein O-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005794	1.000	Golgi apparatus
GO:0005576	0.990	extracellular region
GO:0000139	0.987	Golgi membrane
GO:0005615	0.972	extracellular space
GO:1903561	0.887	extracellular vesicle
GO:0070062	0.881	extracellular exosome
GO:0070013	0.428	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:18705	0.796	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP
EC:2.4.1.102	0.796	acetylglucosaminyltransferase.
RHEA:17413	0.548	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.150	0.548	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase.

[back to server]