StarFunc result for job id O95396

User Input

>input (460 residues)
MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEI
LRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMS
NLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCS
DNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCA
DGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAAC
GERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQV
EVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQK
AVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95396	1.000	1.000	6.191E-96	460	1.000	1.000	O95396.pdb.gz	MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens OX=9606 GN=MOCS3 PE=1 SV=1
2	AFDB:Q9VLJ8	0.850	0.863	2.744E-60	453	0.480	0.488	Q9VLJ8.pdb.gz	MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster OX=7227 GN=Uba4 PE=1 SV=1
3	AFDB:Q386S6	0.815	0.746	1.363E-47	505	0.400	0.364	Q386S6.pdb.gz	Q386S6_TRYB2 Adenylyltransferase and sulfurtransferase MOCS3 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.22.0008 PE=3 SV=1
4	AFDB:Q09810	0.740	0.844	3.155E-45	401	0.370	0.424	Q09810.pdb.gz	UBA4_SCHPO Adenylyltransferase and sulfurtransferase uba4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba4 PE=3 SV=1
5	AFDB:P9WMN7	0.759	0.885	9.154E-45	392	0.343	0.403	P9WMN7.pdb.gz	MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moeZ PE=1 SV=1
6	AFDB:P38820	0.799	0.834	5.732E-44	440	0.372	0.389	P38820.pdb.gz	UBA4_YEAST Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA4 PE=1 SV=1
7	AFDB:P12282	0.517	0.944	5.761E-32	249	0.246	0.454	P12282.pdb.gz	MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=moeB PE=1 SV=1
8	AFDB:D4GSF3	0.533	0.899	3.400E-31	270	0.259	0.441	D4GSF3.pdb.gz	UBAA_HALVD SAMP-activating enzyme E1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=ubaA PE=1 SV=1
9	AFDB:Q8ID54	0.534	0.425	5.792E-31	584	0.257	0.202	Q8ID54.pdb.gz	Q8ID54_PLAF7 Ubiquitin-activating enzyme OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1365400 PE=4 SV=1
10	AFDB:P30138	0.514	0.932	1.058E-28	251	0.226	0.414	P30138.pdb.gz	THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=thiF PE=1 SV=2
11	PDB:1jw9B	0.501	0.944	1.323E-28	240	0.239	0.458	1jw9B.pdb.gz	Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
12	PDB:1zfnA	0.509	0.945	3.267E-25	244	0.222	0.418	1zfnA.pdb.gz	Structural Analysis of Escherichia Coli ThiF.
13	PDB:3h5aC	0.478	0.605	6.937E-17	358	0.148	0.190	3h5aC.pdb.gz	How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
14	PDB:6xoiB	0.416	0.473	1.337E-15	403	0.135	0.154	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
15	PDB:2nvuB	0.439	0.263	1.513E-14	789	0.139	0.081	2nvuB.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
16	PDB:4gskB	0.439	0.359	4.391E-14	572	0.122	0.098	4gskB.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
17	PDB:7pvnB	0.338	0.160	1.005E-13	990	0.098	0.045	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
18	PDB:7solA	0.335	0.154	1.005E-13	1011	0.096	0.044	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
19	PDB:1y8rA	0.416	0.599	1.434E-13	314	0.124	0.182	1y8rA.pdb.gz	Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
20	PDB:3kycB	0.326	0.275	1.521E-13	548	0.102	0.086	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95396	0.0	922	460	1.000	1.000	MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens OX=9606 GN=MOCS3 PE=1 SV=1
2	Q9VLJ8	3.68e-146	426	453	0.489	0.497	MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster OX=7227 GN=Uba4 PE=1 SV=1
3	Q09810	2.38e-95	295	401	0.361	0.414	UBA4_SCHPO Adenylyltransferase and sulfurtransferase uba4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba4 PE=3 SV=1
4	P38820	6.11e-94	292	440	0.352	0.368	UBA4_YEAST Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA4 PE=1 SV=1
5	Q386S6	1.04e-89	283	505	0.407	0.370	Q386S6_TRYB2 Adenylyltransferase and sulfurtransferase MOCS3 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.22.0008 PE=3 SV=1
6	P9WMN7	1.90e-78	251	392	0.357	0.418	MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moeZ PE=1 SV=1
7	P12282	2.54e-63	207	249	0.246	0.454	MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=moeB PE=1 SV=1
8	D4GSF3	9.43e-54	183	270	0.254	0.433	UBAA_HALVD SAMP-activating enzyme E1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=ubaA PE=1 SV=1
9	P30138	1.44e-43	155	251	0.228	0.418	THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=thiF PE=1 SV=2
10	Q8ID54	2.51e-38	149	584	0.157	0.123	Q8ID54_PLAF7 Ubiquitin-activating enzyme OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1365400 PE=4 SV=1
11	Q9SJT1	1.78e-20	96.7	700	0.120	0.079	SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SAE2 PE=1 SV=1
12	O42939	1.49e-19	94.0	628	0.111	0.081	UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba2 PE=1 SV=1
13	Q9UBT2	3.73e-17	86.3	640	0.102	0.073	SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2
14	Q9NAN1	1.10e-16	84.7	582	0.089	0.070	SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans OX=6239 GN=uba-2 PE=3 SV=3
15	Q9Z1F9	5.31e-16	82.8	638	0.098	0.071	SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus OX=10090 GN=Uba2 PE=1 SV=1
16	Q5BAI0	6.04e-16	82.4	610	0.111	0.084	Q5BAI0_EMENI Ubiquitin-like activating enzyme (UbaB), putative (AFU_orthologue AFUA_6G10510) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02450 PE=3 SV=1
17	Q9VSD9	1.19e-15	81.6	700	0.091	0.060	Q9VSD9_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=2 SV=3
18	Q7KJV6	2.11e-15	80.9	700	0.091	0.060	Q7KJV6_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=2 SV=1
19	Q7KUA4	2.36e-15	80.9	700	0.091	0.060	Q7KUA4_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=1 SV=1
20	Q38EW4	6.40e-14	75.5	387	0.167	0.199	Q38EW4_TRYB2 Ubiquitin-like modifier-activating enzyme 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4430 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00581 Rhodanese	1.2e-07	43.5	Rhodanese-like domain
2	PF03435 Sacchrp_dh_NADP	1.9e+02	13.7	Saccharopine dehydrogenase NADP binding domain
3	PF00899 ThiF	1.3e-53	193.0	ThiF family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412922	0.999	Ubiquitin-related modifier 1
2	9606.ENSP00000363205	0.998	Cysteine desulfurase, mitochondrial
3	9606.ENSP00000388320	0.996	Cytoplasmic tRNA 2-thiolation protein 2
4	9606.ENSP00000390011	0.995	Cytoplasmic tRNA 2-thiolation protein 1
5	9606.ENSP00000380157	0.993	Molybdopterin synthase catalytic subunit
6	9606.ENSP00000380402	0.991	3-mercaptopyruvate sulfurtransferase
7	9606.ENSP00000385828	0.984	Thiosulfate sulfurtransferase
8	9606.ENSP00000414851	0.870	Elongator complex protein 2
9	9606.ENSP00000362282	0.868	Molybdenum cofactor biosynthesis protein 1
10	9606.ENSP00000397673	0.867	Alkylated DNA repair protein alkB homolog 8
11	9606.ENSP00000360676	0.849	KTI12 chromatin associated homolog
12	9606.ENSP00000256398	0.846	Elongator complex protein 3
13	9606.ENSP00000368970	0.841	Ubiquitin-fold modifier 1
14	9606.ENSP00000363779	0.833	Elongator complex protein 1
15	9606.ENSP00000274382	0.825	Protein limb expression 1 homolog
16	9606.ENSP00000305974	0.825	Solute carrier organic anion transporter family member 1A2
17	9606.ENSP00000350704	0.825	Uncharacterized protein C1orf109
18	9606.ENSP00000360366	0.825	Acyl-coenzyme A thioesterase 11
19	9606.ENSP00000478070	0.825	CWC25 spliceosome associated protein homolog
20	9606.ENSP00000385836	0.819	Calcium homeostasis modulator protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016779	1.000	nucleotidyltransferase activity
GO:0008641	1.000	ubiquitin-like modifier activating enzyme activity
GO:0004792	0.999	thiosulfate sulfurtransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.996	macromolecule metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0044237	0.995	cellular metabolic process
GO:1901564	0.978	organonitrogen compound metabolic process
GO:0019538	0.971	protein metabolic process
GO:0010467	0.966	gene expression
GO:0006399	0.957	tRNA metabolic process
GO:0006400	0.953	tRNA modification
GO:0002097	0.926	tRNA wobble base modification
GO:0019637	0.880	organophosphate metabolic process
GO:1901576	0.873	organic substance biosynthetic process
GO:0006796	0.850	phosphate-containing compound metabolic process
GO:1901362	0.836	organic cyclic compound biosynthetic process
GO:0002098	0.835	tRNA wobble uridine modification
GO:0044249	0.828	cellular biosynthetic process
GO:0090407	0.724	organophosphate biosynthetic process
GO:0018130	0.643	heterocycle biosynthetic process
GO:1901566	0.574	organonitrogen compound biosynthetic process
GO:0065007	0.365	biological regulation
GO:0036211	0.365	protein modification process
GO:0050789	0.364	regulation of biological process
GO:0050794	0.327	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.882	intracellular membrane-bounded organelle
GO:0005634	0.776	nucleus
GO:0043233	0.545	organelle lumen
GO:0070013	0.541	intracellular organelle lumen
GO:0032991	0.371	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.-.-	1.000	Forming carbon-sulfur bonds.
EC:2.7.7.-	1.000	Nucleotidyltransferases.
RHEA:16881	0.999	hydrogen cyanide + thiosulfate = 2 H(+) + sulfite + thiocyanate
EC:2.8.1.1	0.999	thiosulfate sulfurtransferase.

[back to server]