StarFunc result for job id O95398

User Input

>input (923 residues)
MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
FYRFPGPEPEPVRTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSML
HTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWL
PNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z1C8	0.910	0.907	0.000	926	0.904	0.901	Q9Z1C8.pdb.gz	RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus OX=10116 GN=Rapgef3 PE=2 SV=2
2	AFDB:Q8WZA2	0.727	0.668	5.937E-71	1011	0.450	0.410	Q8WZA2.pdb.gz	RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1
3	PDB:2byvE	0.707	0.708	2.912E-67	922	0.453	0.453	2byvE.pdb.gz
4	PDB:4f7zA	0.691	0.676	3.168E-67	946	0.449	0.438	4f7zA.pdb.gz
5	AFDB:A1Z6P8	0.749	0.690	2.116E-63	1006	0.387	0.355	A1Z6P8.pdb.gz	A1Z6P8_DROME Exchange protein directly activated by cAMP, isoform E OS=Drosophila melanogaster OX=7227 GN=Epac PE=3 SV=3
6	AFDB:A0A590UJR0	0.532	0.553	2.708E-41	883	0.322	0.336	A0A590UJR0.pdb.gz	A0A590UJR0_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=1
7	AFDB:Q9Y4G8	0.510	0.322	5.353E-34	1499	0.221	0.136	Q9Y4G8.pdb.gz	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
8	AFDB:Q8TEU7	0.465	0.281	7.595E-33	1601	0.218	0.126	Q8TEU7.pdb.gz	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
9	AFDB:G5EDB9	0.482	0.313	8.988E-33	1470	0.217	0.136	G5EDB9.pdb.gz	RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
10	AFDB:Q9VMF3	0.493	0.301	7.696E-32	1573	0.229	0.134	Q9VMF3.pdb.gz	Q9VMF3_DROME Dizzy isoform AII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=2
11	AFDB:Q9UHV5	0.475	0.654	1.078E-31	662	0.206	0.287	Q9UHV5.pdb.gz	RPGFL_HUMAN Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens OX=9606 GN=RAPGEFL1 PE=1 SV=2
12	AFDB:A0A0S2Z5S1	0.339	0.682	1.819E-20	444	0.174	0.363	A0A0S2Z5S1.pdb.gz	A0A0S2Z5S1_HUMAN Rap guanine nucleotide exchange factor 5 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=2 SV=1
13	PDB:6byrB	0.121	0.347	2.794E-6	288	0.036	0.115	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:5dykA	0.108	0.120	3.752E-6	809	0.046	0.052	5dykA.pdb.gz
15	PDB:3j4qB	0.118	0.276	4.440E-6	382	0.035	0.084	3j4qB.pdb.gz
16	PDB:4byyA	0.119	0.455	4.830E-6	226	0.037	0.150	4byyA.pdb.gz
17	PDB:4dinB	0.122	0.307	9.881E-6	345	0.043	0.116	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
18	PDB:4avaA	0.105	0.277	1.384E-5	327	0.049	0.138	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
19	PDB:4orfA	0.110	0.297	1.570E-5	319	0.053	0.154	4orfA.pdb.gz
20	PDB:7n15A	0.119	0.206	1.638E-5	520	0.035	0.062	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KF54	0.0	611	935	0.385	0.380	A0A0B4KF54_DROME Exchange protein directly activated by cAMP, isoform F OS=Drosophila melanogaster OX=7227 GN=Epac PE=3 SV=1
2	A1Z6P8	0.0	609	1006	0.385	0.353	A1Z6P8_DROME Exchange protein directly activated by cAMP, isoform E OS=Drosophila melanogaster OX=7227 GN=Epac PE=3 SV=3
3	O95398	0.0	1895	923	1.000	1.000	RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=RAPGEF3 PE=1 SV=6
4	Q7K3Z6	0.0	610	861	0.385	0.412	Q7K3Z6_DROME Exchange protein directly activated by cAMP, isoform D OS=Drosophila melanogaster OX=7227 GN=Epac PE=2 SV=1
5	Q8VCC8	0.0	1697	918	0.898	0.903	RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus OX=10090 GN=Rapgef3 PE=1 SV=2
6	Q8WZA2	0.0	836	1011	0.466	0.425	RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1
7	Q9EQZ6	0.0	833	1011	0.467	0.426	RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus OX=10090 GN=Rapgef4 PE=1 SV=1
8	Q9Z1C8	0.0	1716	926	0.905	0.902	RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus OX=10116 GN=Rapgef3 PE=2 SV=2
9	A0A590UJR0	5.42e-133	422	883	0.314	0.328	A0A590UJR0_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=1
10	Q9Z1C7	2.22e-127	393	436	0.223	0.472	RPGF4_RAT Rap guanine nucleotide exchange factor 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rapgef4 PE=2 SV=1
11	A8MQ07	6.34e-124	394	730	0.294	0.371	A8MQ07_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=3
12	A0A0S2Z561	1.70e-106	343	580	0.222	0.353	A0A0S2Z561_HUMAN HCG38228, isoform CRA_b (Fragment) OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=2 SV=1
13	Q92565	1.70e-106	343	580	0.222	0.353	RPGF5_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=1
14	Q9UHV5	7.31e-84	285	662	0.203	0.282	RPGFL_HUMAN Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens OX=9606 GN=RAPGEFL1 PE=1 SV=2
15	A0A0S2Z5S1	4.55e-54	196	444	0.105	0.218	A0A0S2Z5S1_HUMAN Rap guanine nucleotide exchange factor 5 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=2 SV=1
16	G5ECB8	2.14e-44	176	1146	0.126	0.101	G5ECB8_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
17	G5ECE2	3.15e-44	176	1188	0.125	0.097	G5ECE2_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
18	G5EEE0	4.59e-44	176	1305	0.125	0.088	G5EEE0_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
19	G5EDB9	6.12e-44	175	1470	0.125	0.078	RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
20	A0A2R8Y661	3.24e-39	160	1559	0.112	0.066	A0A2R8Y661_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15915 BAT	2.2e+02	13.1	GAF and HTH_10 associated domain
2	PF00027 cNMP_binding	3e-13	61.0	Cyclic nucleotide-binding domain
3	PF00610 DEP	3.2e-11	54.4	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
4	PF00617 RasGEF	4.7e-43	159.0	RasGEF domain
5	PF00618 RasGEF_N	6.4e-13	60.2	RasGEF N-terminal motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280979	0.988	A-kinase anchor protein 6
2	9606.ENSP00000358723	0.986	Ras-related protein Rap-1A
3	9606.ENSP00000250559	0.984	Ras-related protein Rap-1b
4	9606.ENSP00000421922	0.976	Alpha-2-macroglobulin receptor-associated protein
5	9606.ENSP00000319096	0.966	Ras-related protein Rap-2b
6	9606.ENSP00000303960	0.955	ATP-binding cassette sub-family C member 8
7	9606.ENSP00000311005	0.954	Mitogen-activated protein kinase 7
8	9606.ENSP00000283195	0.946	E3 SUMO-protein ligase RanBP2
9	9606.ENSP00000282096	0.925	cGMP-inhibited 3',5'-cyclic phosphodiesterase B
10	9606.ENSP00000345708	0.916	ATP-sensitive inward rectifier potassium channel 11
11	9606.ENSP00000312999	0.912	Guanine nucleotide-binding protein G(i) subunit alpha-2
12	9606.ENSP00000358867	0.908	Guanine nucleotide-binding protein G(k) subunit alpha
13	9606.ENSP00000286355	0.906	Adenylate cyclase type 8
14	9606.ENSP00000343027	0.905	Guanine nucleotide-binding protein G(i) subunit alpha-1
15	9606.ENSP00000478212	0.900	A-kinase anchor protein 1, mitochondrial
16	9606.ENSP00000386444	0.896	S-arrestin
17	9606.ENSP00000378207	0.889	A-kinase anchor protein 5
18	9606.ENSP00000360141	0.886	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
19	9606.ENSP00000246792	0.873	Ras-related protein R-Ras
20	9606.ENSP00000297323	0.871	Adenylate cyclase type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005085	0.998	guanyl-nucleotide exchange factor activity
GO:0043167	0.958	ion binding
GO:0097159	0.954	organic cyclic compound binding
GO:1901363	0.952	heterocyclic compound binding
GO:0032555	0.940	purine ribonucleotide binding
GO:0043168	0.933	anion binding
GO:0030551	0.928	cyclic nucleotide binding
GO:0030552	0.919	cAMP binding
GO:0019904	0.617	protein domain specific binding
GO:0005096	0.411	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0009987	0.990	cellular process
GO:0051716	0.979	cellular response to stimulus
GO:0032501	0.933	multicellular organismal process
GO:0048519	0.932	negative regulation of biological process
GO:0065009	0.931	regulation of molecular function
GO:0032502	0.928	developmental process
GO:0048518	0.927	positive regulation of biological process
GO:0048856	0.924	anatomical structure development
GO:0019222	0.921	regulation of metabolic process
GO:0048522	0.914	positive regulation of cellular process
GO:0080090	0.912	regulation of primary metabolic process
GO:0042221	0.911	response to chemical
GO:0031323	0.908	regulation of cellular metabolic process
GO:0044093	0.901	positive regulation of molecular function
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0051171	0.874	regulation of nitrogen compound metabolic process
GO:0007154	0.862	cell communication
GO:0010033	0.858	response to organic substance
GO:0007165	0.854	signal transduction
GO:0033043	0.833	regulation of organelle organization
GO:0003158	0.833	endothelium development
GO:0051246	0.830	regulation of protein metabolic process
GO:1901701	0.826	cellular response to oxygen-containing compound
GO:0031399	0.818	regulation of protein modification process
GO:0009719	0.796	response to endogenous stimulus
GO:0071310	0.794	cellular response to organic substance
GO:0050790	0.761	regulation of catalytic activity
GO:0032970	0.744	regulation of actin filament-based process
GO:0048523	0.735	negative regulation of cellular process
GO:0032956	0.712	regulation of actin cytoskeleton organization
GO:0044087	0.700	regulation of cellular component biogenesis
GO:0030154	0.684	cell differentiation
GO:0007275	0.677	multicellular organism development
GO:0048468	0.602	cell development
GO:1901698	0.597	response to nitrogen compound
GO:1902903	0.593	regulation of supramolecular fiber organization
GO:0009893	0.587	positive regulation of metabolic process
GO:0032879	0.576	regulation of localization
GO:0014070	0.575	response to organic cyclic compound
GO:0051049	0.571	regulation of transport
GO:0071495	0.539	cellular response to endogenous stimulus
GO:0001885	0.538	endothelial cell development
GO:0110053	0.523	regulation of actin filament organization
GO:0051130	0.519	positive regulation of cellular component organization
GO:0032231	0.505	regulation of actin filament bundle assembly
GO:0051247	0.488	positive regulation of protein metabolic process
GO:0019220	0.475	regulation of phosphate metabolic process
GO:0001932	0.458	regulation of protein phosphorylation
GO:0031325	0.433	positive regulation of cellular metabolic process
GO:0110020	0.430	regulation of actomyosin structure organization
GO:0010243	0.427	response to organonitrogen compound
GO:0065008	0.425	regulation of biological quality
GO:0001934	0.381	positive regulation of protein phosphorylation
GO:0051336	0.379	regulation of hydrolase activity
GO:0071407	0.375	cellular response to organic cyclic compound
GO:0071417	0.375	cellular response to organonitrogen compound
GO:0043087	0.372	regulation of GTPase activity
GO:0048583	0.355	regulation of response to stimulus
GO:0010646	0.338	regulation of cell communication
GO:0048731	0.335	system development
GO:0023051	0.323	regulation of signaling
GO:0035556	0.318	intracellular signal transduction
GO:0046683	0.317	response to organophosphorus
GO:0050793	0.313	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0005886	0.996	plasma membrane
GO:0043227	0.995	membrane-bounded organelle
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0005576	0.971	extracellular region
GO:0031982	0.959	vesicle
GO:0005615	0.918	extracellular space
GO:1903561	0.909	extracellular vesicle
GO:0070062	0.890	extracellular exosome
GO:0005829	0.877	cytosol
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0030054	0.688	cell junction
GO:0120025	0.687	plasma membrane bounded cell projection
GO:0005856	0.555	cytoskeleton
GO:0045202	0.412	synapse
GO:0005938	0.389	cell cortex
GO:0031252	0.383	cell leading edge
GO:0015629	0.336	actin cytoskeleton
GO:0030027	0.301	lamellipodium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]