StarFunc result for job id O95405

User Input

>input (1425 residues)
MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESA
VSNESQPQLKVFSLAHSAPLTTEEEDHCANGQDCNLNPEIATMWIDENAVAEDQLIKRNY
SWDDQCSAVEVGEKKCGNLACLPDEKNVLVVAVMHNCDKRTLQNDLQDCNNYNSQSLMDA
FSCSLDNENRQTDQFSFSINESTEKDMNSEKQMDPLNRPKTEGRSVNHLCPTSSDSLASV
CSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSP
RTDLGSPNSFSHMSEGILMKKEPAEESTTEESLRSGLPLLLKPDMPNGSGRNNDCERCSD
CLVPNEVRADENEGYEHEETLGTTEFLNMTEHFSESQDMTNWKLTKLNEMNDSQVNEEKE
KFLQISQPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDS
YGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNEATEGSGLLLNSTGD
LMKKNYLHNFCSQVPSVLGQSSPKVVASLPSISVPFGGARPKQPSNLKLQIPKPLSDHLQ
NDFPANSGNNTKNKNDILGKAKLGENSATNVCSPSLGNISNVDTNGEHLESYEAEISTRP
CLALAPDSPDNDLRAGQFGISARKPFTTLGEVAPVWVPDSQAPNCMKCEARFTFTKRRHH
CRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVLMNAQAWENMMSASSQSPNPNNPA
EYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGAEVAQPREQRRVWFADGILPNGEV
ADAAKLTMNGTSSAGTLAVSHDPVKPVTTSPLPAETDICLFSGSITQVGSPVGSAMNLIP
EDGLPPILISTGVKGDYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNYVNR
KCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVSNLGHSFF
SQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLFGILIQKWETPWAKVFPIRLMLRLGA
EYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIP
SNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKVTGA
SFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEP
QEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLEND
DQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSN
GQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A8R0	0.520	0.529	0.000	1397	0.873	0.890	A2A8R0.pdb.gz	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
2	AFDB:A5PMI2	0.457	0.528	0.000	1216	0.540	0.632	A5PMI2.pdb.gz	A5PMI2_DANRE Zinc finger FYVE domain-containing protein 9 isoform X1 OS=Danio rerio OX=7955 GN=zfyve9a PE=4 SV=2
3	AFDB:O95405	1.000	1.000	0.000	1425	1.000	1.000	O95405.pdb.gz	ZFYV9_HUMAN Zinc finger FYVE domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZFYVE9 PE=1 SV=2
4	AFDB:Q7Z3T8	0.372	0.345	3.164E-101	1539	0.358	0.331	Q7Z3T8.pdb.gz	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
5	PDB:4blaD	0.105	0.191	4.583E-8	738	0.031	0.060	4blaD.pdb.gz
6	PDB:4kmaA	0.121	0.328	4.023E-6	440	0.035	0.114	4kmaA.pdb.gz
7	PDB:7eqgD	0.042	0.133	4.015E-3	309	0.013	0.058	7eqgD.pdb.gz	AcrIF5 specifically targets DNA-bound CRISPR-Cas surveillance complex for inhibition.
8	PDB:7elmE	0.041	0.136	7.790E-3	337	0.012	0.050	7elmE.pdb.gz	Insights into the inhibition of type I-F CRISPR-Cas system by a multifunctional anti-CRISPR protein AcrIF24.
9	PDB:6vqvE	0.042	0.140	2.106E-2	285	0.014	0.070	6vqvE.pdb.gz	Inhibition mechanisms of AcrF9, AcrF8, and AcrF6 against type I-F CRISPR-Cas complex revealed by cryo-EM.
10	PDB:2wzpA	0.040	0.117	1.045E-1	266	0.020	0.109	2wzpA.pdb.gz
11	AFDB:B7Z126	0.048	0.047	1.050E-1	1489	0.099	0.095	B7Z126.pdb.gz	B7Z126_DROME Tousled-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
12	AFDB:Q9VFH4	0.031	0.033	1.050E-1	1200	0.104	0.123	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
13	AFDB:Q8N1G0	0.034	0.038	1.239E-1	1237	0.075	0.086	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
14	AFDB:Q55C49	0.032	0.041	1.384E-1	1006	0.081	0.115	Q55C49.pdb.gz	GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum OX=44689 GN=gtaG PE=4 SV=1
15	AFDB:Q8IRB5	0.034	0.033	1.463E-1	1465	0.086	0.084	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
16	AFDB:P48415	0.028	0.020	1.546E-1	2195	0.109	0.071	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
17	PDB:6dlfA	0.032	0.120	1.626E-1	236	0.013	0.081	6dlfA.pdb.gz
18	PDB:5svcB	0.045	0.075	3.936E-1	710	0.011	0.021	5svcB.pdb.gz	Structural Basis for the Mechanism of ATP-Dependent Acetone Carboxylation.
19	PDB:7ypbC	0.041	0.042	4.159E-1	1292	0.030	0.033	7ypbC.pdb.gz	Structural basis for intrinsic transcription termination.
20	PDB:3w40A	0.034	0.122	4.645E-1	199	0.009	0.065	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0S860	0.0	1434	706	0.479	0.967	A0S860_MOUSE Zinc finger FYVE domain-containing protein 9 splice variant Z2.1 OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
2	A2A8R0	0.0	2490	1397	0.874	0.891	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
3	A5PMI2	0.0	1358	1216	0.469	0.549	A5PMI2_DANRE Zinc finger FYVE domain-containing protein 9 isoform X1 OS=Danio rerio OX=7955 GN=zfyve9a PE=4 SV=2
4	A8Y5G5	0.0	2299	1338	0.824	0.877	A8Y5G5_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
5	E1C6T3	0.0	2199	1416	0.773	0.778	E1C6T3_CHICK Zinc finger FYVE domain-containing protein OS=Gallus gallus OX=9031 GN=ZFYVE9 PE=4 SV=2
6	O95405	0.0	2965	1425	1.000	1.000	ZFYV9_HUMAN Zinc finger FYVE domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZFYVE9 PE=1 SV=2
7	Q7K9H6	0.0	582	1343	0.240	0.255	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
8	Q7Z3T8	0.0	721	1539	0.267	0.247	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
9	Q80XL0	0.0	547	267	0.182	0.974	Q80XL0_MOUSE Zfyve9 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfyve9 PE=2 SV=1
10	Q960V6	0.0	578	1343	0.239	0.254	Q960V6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=2 SV=1
11	Q6PDX5	3.34e-164	494	242	0.165	0.971	Q6PDX5_MOUSE Zfyve9 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfyve9 PE=2 SV=1
12	Q3UXU9	2.73e-32	124	112	0.042	0.536	Q3UXU9_MOUSE Smad anchor for receptor activation-like Smad-binding domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=2 SV=1
13	Q7Z6J4	3.28e-13	76.6	655	0.023	0.050	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
14	Q8BY35	1.76e-12	74.3	655	0.022	0.049	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
15	Q96M96	3.10e-12	73.9	766	0.022	0.040	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
16	Q91ZT5	5.30e-12	73.2	766	0.021	0.039	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
17	O88387	5.34e-12	73.2	766	0.021	0.039	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
18	Q49A55	5.54e-12	72.4	471	0.022	0.066	Q49A55_HUMAN FGD4 protein OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=1
19	O76902	7.74e-12	70.5	316	0.023	0.104	PKHF1_DROME Pleckstrin homology domain-containing family F member 1 homolog OS=Drosophila melanogaster OX=7227 GN=rush PE=1 SV=1
20	Q9BQ24	1.08e-11	68.6	234	0.020	0.120	ZFY21_HUMAN Zinc finger FYVE domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZFYVE21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11979 DUF3480	1.3e-169	575.4	Domain of unknown function (DUF3480)
2	PF01363 FYVE	1.9e-14	64.9	FYVE zinc finger
3	PF11409 SARA	9.5e-15	65.8	Smad anchor for receptor activation (SARA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262160	0.999	Mothers against decapentaplegic homolog 2
2	9606.ENSP00000332973	0.999	Mothers against decapentaplegic homolog 3
3	9606.ENSP00000364133	0.986	TGF-beta receptor type-1
4	9606.ENSP00000341551	0.980	Mothers against decapentaplegic homolog 4
5	9606.ENSP00000268058	0.975	Protein PML
6	9606.ENSP00000326031	0.974	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
7	9606.ENSP00000351905	0.974	TGF-beta receptor type-2
8	9606.ENSP00000262158	0.960	Mothers against decapentaplegic homolog 7
9	9606.ENSP00000262435	0.956	E3 ubiquitin-protein ligase SMURF2
10	9606.ENSP00000354621	0.947	E3 ubiquitin-protein ligase SMURF1
11	9606.ENSP00000238682	0.941	Transforming growth factor beta-3
12	9606.ENSP00000200453	0.939	Protein phosphatase 1 regulatory subunit 15A
13	9606.ENSP00000383003	0.921	Peptidyl-prolyl cis-trans isomerase FKBP1A
14	9606.ENSP00000221930	0.914	Transforming growth factor beta-1
15	9606.ENSP00000339191	0.914	Caveolin-1
16	9606.ENSP00000341779	0.913	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
17	9606.ENSP00000392270	0.907	Serine-threonine kinase receptor-associated protein
18	9606.ENSP00000377265	0.900	Transcription factor AP-2-beta
19	9606.ENSP00000265562	0.891	Tyrosine-protein phosphatase non-receptor type 23
20	9606.ENSP00000242719	0.874	RING finger protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035091	0.945	phosphatidylinositol binding
GO:0005545	0.769	1-phosphatidylinositol binding
GO:0019904	0.726	protein domain specific binding
GO:0019899	0.530	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007178	0.995	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071363	0.994	cellular response to growth factor stimulus
GO:0071559	0.981	response to transforming growth factor beta
GO:0071560	0.959	cellular response to transforming growth factor beta stimulus
GO:0007179	0.949	transforming growth factor beta receptor signaling pathway
GO:0019222	0.323	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005769	0.998	early endosome
GO:0005829	0.993	cytosol
GO:0032991	0.986	protein-containing complex
GO:0031090	0.964	organelle membrane
GO:0098588	0.868	bounding membrane of organelle
GO:0030659	0.803	cytoplasmic vesicle membrane
GO:0010008	0.775	endosome membrane
GO:0031901	0.708	early endosome membrane
GO:0005634	0.654	nucleus
GO:0031981	0.568	nuclear lumen
GO:0005654	0.525	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]