StarFunc result for job id O95407

User Input

>input (300 residues)
MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQR
PCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFF
AHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLA
LNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPE
GWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95407	1.000	1.000	5.471E-61	300	1.000	1.000	O95407.pdb.gz	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
2	AFDB:O08712	0.510	0.394	4.797E-23	401	0.287	0.214	O08712.pdb.gz	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
3	AFDB:O00300	0.499	0.384	9.111E-23	401	0.303	0.227	O00300.pdb.gz	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
4	AFDB:A5D8S6	0.459	0.230	8.615E-21	637	0.247	0.116	A5D8S6.pdb.gz	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
5	AFDB:D3ZF92	0.498	0.240	2.130E-19	655	0.227	0.104	D3ZF92.pdb.gz	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
6	AFDB:O75509	0.503	0.242	1.225E-18	655	0.230	0.105	O75509.pdb.gz	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
7	AFDB:A0A2R8QCA6	0.496	0.609	5.917E-18	241	0.203	0.253	A0A2R8QCA6.pdb.gz
8	AFDB:Q4QQW2	0.436	0.451	1.302E-16	289	0.197	0.204	Q4QQW2.pdb.gz
9	AFDB:P20333	0.454	0.306	3.122E-16	461	0.233	0.152	P20333.pdb.gz	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
10	AFDB:P25942	0.439	0.472	7.489E-16	277	0.183	0.199	P25942.pdb.gz	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
11	PDB:2hm2Q	0.199	0.561	1.587E-1	89	0.050	0.169	2hm2Q.pdb.gz
12	PDB:7dtvA	0.141	0.064	2.387E-1	779	0.123	0.047	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
13	PDB:6p6cA	0.166	0.414	4.535E-1	90	0.040	0.133	6p6cA.pdb.gz
14	PDB:3j9kB	0.203	0.460	6.435E-1	102	0.040	0.118	3j9kB.pdb.gz	Structure of the apoptosome: mechanistic insights into activation of an initiator caspase from Drosophila.
15	PDB:5y27A	0.096	0.244	6.821E-1	98	0.043	0.133	5y27A.pdb.gz
16	PDB:6wjv4	0.086	0.196	7.231E-1	107	0.060	0.168	6wjv4.pdb.gz
17	PDB:7pzcA	0.199	0.064	1.088	1010	0.027	0.008	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
18	PDB:5h7nB	0.217	0.149	1.153	460	0.050	0.033	5h7nB.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
19	PDB:7epaA	0.103	0.050	1.296	782	0.140	0.054	7epaA.pdb.gz
20	PDB:7ktsF	0.094	0.083	1.373	351	0.067	0.057	7ktsF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95407	0.0	600	300	1.000	1.000	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
2	O00300	6.01e-47	164	401	0.280	0.209	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
3	O08712	4.79e-44	156	401	0.267	0.200	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
4	O08727	1.18e-43	155	401	0.270	0.202	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
5	A5D8S6	1.41e-30	123	637	0.237	0.111	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
6	P25119	3.32e-28	115	474	0.197	0.124	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
7	P20333	6.35e-27	111	461	0.200	0.130	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
8	D3ZF92	3.68e-23	101	655	0.193	0.089	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
9	Q9EPU5	5.47e-23	100	655	0.190	0.087	TNR21_MOUSE Tumor necrosis factor receptor superfamily member 21 OS=Mus musculus OX=10090 GN=Tnfrsf21 PE=1 SV=2
10	O75509	1.73e-22	99.8	655	0.183	0.084	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
11	Q80WY6	2.81e-22	98.6	474	0.187	0.118	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
12	P36941	2.77e-21	95.1	435	0.240	0.166	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
13	Q71F55	5.93e-19	86.7	276	0.187	0.203	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
14	Q80WM9	6.14e-19	86.7	275	0.187	0.204	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
15	F5H6F8	6.34e-18	82.8	217	0.230	0.318	F5H6F8_HUMAN Lymphotoxin beta receptor (Fragment) OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=8
16	P50284	3.74e-17	83.2	415	0.183	0.133	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
17	F1RAS9	1.45e-16	81.6	425	0.190	0.134	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
18	Q92956	2.16e-16	79.7	283	0.187	0.198	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
19	Q9Y6Q6	1.14e-15	79.3	616	0.160	0.078	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
20	A0A8I6A4J5	3.95e-15	75.9	260	0.173	0.200	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06055 ExoD	5.8e+02	11.3	Exopolysaccharide synthesis, ExoD
2	PF00020 TNFR_c6	7.9e-21	85.5	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480348

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356694	0.997	Tumor necrosis factor ligand superfamily member 6
2	9606.ENSP00000363157	0.995	Tumor necrosis factor ligand superfamily member 15
3	9606.ENSP00000469049	0.915	Tumor necrosis factor ligand superfamily member 14
4	9606.ENSP00000359013	0.800	Tumor necrosis factor receptor superfamily, member 6b, decoy
5	9606.ENSP00000398698	0.742	Tumor necrosis factor
6	9606.ENSP00000353332	0.648	Regulator of telomere elongation helicase 1
7	9606.ENSP00000410452	0.642	Stathmin
8	9606.ENSP00000367013	0.634	Tumor necrosis factor receptor superfamily member 25
9	9606.ENSP00000483059	0.612	Nuclear receptor subfamily 2 group C member 2
10	9606.ENSP00000162749	0.556	Tumor necrosis factor receptor superfamily member 1A
11	9606.ENSP00000241261	0.541	Tumor necrosis factor ligand superfamily member 10
12	9606.ENSP00000332013	0.532	Zinc finger CCCH-type with G patch domain-containing protein
13	9606.ENSP00000349324	0.517	Tumor necrosis factor receptor superfamily member 10C
14	9606.ENSP00000357103	0.510	Atypical chemokine receptor 1
15	9606.ENSP00000303356	0.506	L-xylulose reductase
16	9606.ENSP00000276431	0.503	Tumor necrosis factor receptor superfamily member 10B
17	9606.ENSP00000310263	0.503	Tumor necrosis factor receptor superfamily member 10D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.520	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0042981	0.979	regulation of apoptotic process
GO:0043066	0.945	negative regulation of apoptotic process
GO:0009987	0.818	cellular process
GO:0050896	0.791	response to stimulus
GO:0051716	0.712	cellular response to stimulus
GO:0048518	0.682	positive regulation of biological process
GO:0007154	0.670	cell communication
GO:0048522	0.667	positive regulation of cellular process
GO:0023052	0.656	signaling
GO:0007165	0.634	signal transduction
GO:0019222	0.509	regulation of metabolic process
GO:0060255	0.416	regulation of macromolecule metabolic process
GO:0080090	0.354	regulation of primary metabolic process
GO:0051171	0.352	regulation of nitrogen compound metabolic process
GO:0048583	0.321	regulation of response to stimulus
GO:0031323	0.303	regulation of cellular metabolic process
GO:0007166	0.302	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005576	0.994	extracellular region
GO:0005886	0.962	plasma membrane
GO:0005622	0.897	intracellular anatomical structure
GO:0043231	0.766	intracellular membrane-bounded organelle
GO:0005737	0.636	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]