StarFunc result for job id O95409

User Input

>input (532 residues)
MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF
KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL
FRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMR
LGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHHP
GAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNH
VCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGE
KPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGS
GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RDY6	0.266	0.266	1.590E-67	532	1.000	1.000	A0A024RDY6.pdb.gz
2	AFDB:Q91689	0.334	0.353	5.753E-57	503	0.737	0.779	Q91689.pdb.gz	ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis OX=8355 GN=zic2-a PE=2 SV=2
3	AFDB:Q61467	0.320	0.493	1.511E-34	341	0.370	0.578	Q61467.pdb.gz	ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus OX=10090 GN=Zic4 PE=1 SV=2
4	AFDB:B2BM15	0.302	0.325	5.771E-34	494	0.447	0.482	B2BM15.pdb.gz	B2BM15_DANRE Zic family member 4 OS=Danio rerio OX=7955 GN=fj36d02 PE=2 SV=1
5	AFDB:A0A0R4IE83	0.277	0.299	2.811E-19	489	0.229	0.249	A0A0R4IE83.pdb.gz	A0A0R4IE83_DANRE GLIS family zinc finger 2b OS=Danio rerio OX=7955 GN=si:rp71-84k24.2 PE=3 SV=1
6	AFDB:A0A5K4F1D0	0.262	0.058	4.056E-16	2566	0.205	0.042	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
7	AFDB:P47043	0.236	0.146	2.692E-11	880	0.184	0.111	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
8	AFDB:P26632	0.152	0.158	6.577E-11	511	0.165	0.172	P26632.pdb.gz	EGR1_DANRE Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2
9	AFDB:Q13118	0.167	0.184	1.946E-10	480	0.150	0.167	Q13118.pdb.gz	KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens OX=9606 GN=KLF10 PE=1 SV=1
10	AFDB:P18146	0.150	0.147	2.074E-10	543	0.207	0.203	P18146.pdb.gz	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
11	PDB:4v6wAT	0.059	0.161	2.822	154	0.026	0.091	4v6wAT.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:5c8dE	0.040	0.066	3.206	280	0.017	0.032	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
13	PDB:5vvrB	0.053	0.030	3.206	1207	0.055	0.024	5vvrB.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
14	PDB:4wa6D	0.050	0.059	3.417	415	0.026	0.034	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
15	PDB:1zl9A	0.067	0.130	5.341	207	0.017	0.043	1zl9A.pdb.gz	Crystal structure of a major nematode C.elegans specific GST (CE01613)
16	PDB:6cozA	0.049	0.110	5.341	160	0.045	0.150	6cozA.pdb.gz
17	PDB:6o9lQ	0.060	0.070	5.341	430	0.041	0.051	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:1m0uA	0.052	0.120	6.068	203	0.023	0.059	1m0uA.pdb.gz	Structure of a Drosophila Sigma Class Glutathione S-transferase Reveals a Novel Active Site Topography Suited for Lipid Peroxidation Products
19	PDB:5d9vA	0.048	0.095	6.894	211	0.023	0.057	5d9vA.pdb.gz	Structural understanding of the recycling of oxidized ascorbate by dehydroascorbate reductase (OsDHAR) from Oryza sativa L. japonica
20	PDB:5l4kQ	0.045	0.053	6.894	422	0.015	0.019	5l4kQ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O57311	0.0	533	441	0.536	0.646	ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis OX=8355 GN=zic3 PE=2 SV=3
2	O60481	0.0	545	467	0.564	0.642	ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens OX=9606 GN=ZIC3 PE=1 SV=1
3	O73689	0.0	603	443	0.581	0.698	ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis OX=8355 GN=zic1 PE=2 SV=1
4	O93311	0.0	587	442	0.579	0.697	O93311_DANRE Odd-paired-like OS=Danio rerio OX=7955 GN=opl PE=2 SV=1
5	O95409	0.0	1071	532	1.000	1.000	ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens OX=9606 GN=ZIC2 PE=1 SV=2
6	P46684	0.0	571	447	0.590	0.702	ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus OX=10090 GN=Zic1 PE=1 SV=2
7	Q15915	0.0	575	447	0.594	0.707	ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens OX=9606 GN=ZIC1 PE=1 SV=2
8	Q62520	0.0	1041	530	0.981	0.985	ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus OX=10090 GN=Zic2 PE=1 SV=2
9	Q62521	0.0	545	466	0.566	0.646	ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus OX=10090 GN=Zic3 PE=1 SV=2
10	Q6PV84	0.0	564	448	0.560	0.665	Q6PV84_DANRE ZIC family member 3 heterotaxy 1 (Odd-paired homolog, Drosophila) OS=Danio rerio OX=7955 GN=wu:fj52a10 PE=2 SV=1
11	Q8JJC0	0.0	598	444	0.598	0.716	ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus OX=9031 GN=ZIC1 PE=1 SV=1
12	Q91689	0.0	617	503	0.667	0.706	ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis OX=8355 GN=zic2-a PE=2 SV=2
13	Q9DE40	0.0	588	427	0.588	0.733	Q9DE40_DANRE ZIC family member 2 (Odd-paired homolog, Drosophila) B OS=Danio rerio OX=7955 GN=zic2 PE=2 SV=2
14	Q9IAT0	0.0	711	445	0.707	0.845	Q9IAT0_DANRE ZIC family member 2 (Odd-paired homolog, Drosophila), A OS=Danio rerio OX=7955 GN=cb851 PE=2 SV=1
15	Q08BV0	3.84e-144	424	466	0.459	0.524	Q08BV0_DANRE Zic family member4 OS=Danio rerio OX=7955 GN=wu:fj36d02 PE=2 SV=1
16	A0JC51	1.33e-143	426	530	0.466	0.468	ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis OX=8355 GN=zic4 PE=2 SV=1
17	B2BM15	1.78e-141	419	494	0.425	0.457	B2BM15_DANRE Zic family member 4 OS=Danio rerio OX=7955 GN=fj36d02 PE=2 SV=1
18	Q9IB89	1.24e-132	397	515	0.432	0.447	ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis OX=8355 GN=zic5 PE=2 SV=1
19	Q6VUB8	1.28e-128	386	497	0.398	0.427	Q6VUB8_DANRE ZIC family member 5 (Odd-paired homolog, Drosophila) OS=Danio rerio OX=7955 GN=zic5 PE=2 SV=1
20	Q61467	1.58e-128	380	341	0.368	0.575	ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus OX=10090 GN=Zic4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	7.2e-18	75.1	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	0.7	21.9	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	0.25	22.7	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	7.1	18.4	C2H2-type zinc ribbon
5	PF12171 zf-C2H2_jaz	0.2	23.2	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	1.9e-15	67.7	Zinc-finger double domain
7	PF12874 zf-met	18	17.1	Zinc-finger of C2H2 type
8	PF18366 zf_ZIC	4.4e-22	89.2	Zic proteins zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365514

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259915	0.844	POU domain, class 5, transcription factor 1
2	9606.ENSP00000381097	0.819	Ephrin type-B receptor 1
3	9606.ENSP00000260653	0.782	Homeobox protein SIX3
4	9606.ENSP00000284476	0.771	Protein dispatched homolog 1
5	9606.ENSP00000297261	0.744	Sonic hedgehog protein
6	9606.ENSP00000356520	0.712	ATP-dependent RNA helicase A
7	9606.ENSP00000343819	0.701	Homeobox protein OTX2
8	9606.ENSP00000323588	0.667	Transcription factor SOX-2
9	9606.ENSP00000344456	0.661	Catenin beta-1
10	9606.ENSP00000400341	0.658	Hepatocyte nuclear factor 3-beta
11	9606.ENSP00000267294	0.649	Zinc finger protein ZIC 5
12	9606.ENSP00000424226	0.645	Teneurin-3
13	9606.ENSP00000272369	0.643	Homeobox protein Meis1
14	9606.ENSP00000358404	0.624	Transcription factor 7-like 2
15	9606.ENSP00000226382	0.618	Paired mesoderm homeobox protein 2B
16	9606.ENSP00000359567	0.615	Transcription factor SOX-3
17	9606.ENSP00000327959	0.606	Homeobox protein TGIF1
18	9606.ENSP00000390436	0.602	Zinc finger protein GLI2
19	9606.ENSP00000302756	0.599	Forkhead box D4 like 1
20	9606.ENSP00000328596	0.599	Homeobox protein SIX6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.999	multicellular organismal process
GO:0048856	0.997	anatomical structure development
GO:0007275	0.986	multicellular organism development
GO:0048731	0.962	system development
GO:0050794	0.958	regulation of cellular process
GO:0009987	0.934	cellular process
GO:0048513	0.908	animal organ development
GO:0007399	0.895	nervous system development
GO:0019222	0.880	regulation of metabolic process
GO:0010468	0.863	regulation of gene expression
GO:0080090	0.856	regulation of primary metabolic process
GO:0051171	0.851	regulation of nitrogen compound metabolic process
GO:0031323	0.851	regulation of cellular metabolic process
GO:0051252	0.731	regulation of RNA metabolic process
GO:0009889	0.716	regulation of biosynthetic process
GO:0006355	0.706	regulation of DNA-templated transcription
GO:0007417	0.662	central nervous system development
GO:0009653	0.560	anatomical structure morphogenesis
GO:0048518	0.472	positive regulation of biological process
GO:0006357	0.469	regulation of transcription by RNA polymerase II
GO:0048522	0.459	positive regulation of cellular process
GO:0048519	0.379	negative regulation of biological process
GO:0048523	0.370	negative regulation of cellular process
GO:0010604	0.362	positive regulation of macromolecule metabolic process
GO:0030154	0.346	cell differentiation
GO:0045893	0.344	positive regulation of DNA-templated transcription
GO:0045944	0.334	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.991	nuclear lumen
GO:0005654	0.983	nucleoplasm
GO:0005737	0.801	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]