StarFunc result for job id O95425

User Input

>input (2214 residues)
MKRKERIARRLEGIENDTQPILLQSCTGLVTHRLLEEDTPRYMRASDPASPHIGRSNEEE
ETSDSSLEKQTRSKYCTETSGVHGDSPYGSGTMDTHSLESKAERIARYKAERRRQLAEKY
GLTLDPEADSEYLSRYTKSRKEPDAVEKRGGKSDKQEESSRDASSLYPGTETMGLRTCAG
ESKDYALHVGDGSSDPEVLLNIENQRRGQELSATRQAHDLSPAAESSSTFSFSGRDSSFT
EVPRSPKHAHSSSLQQAASRSPSFGDPQLSPEARPSTGKPKHEWFLQKDSEGDTPSLINW
PSRVKVREKLVKEESARNSPELASESVTQRRHQPAPVHYVSFQSEHSAFDRVPSKAAGST
RQPIRGYVQPADTGHTAKLVTPETPENASECSWVASATQNVPKPPSLTVLEGDGRDSPVL
HVCESKAEEEEGEGEGEEKEEDVCFTEALEQSKKTLLALEGDGLVRSPEDPSRNEDFGKP
AVSTVTLEHQKELENVAQPPQAPHQPTERTGRSEMVLYIQSEPVSQDAKPTGHNREASKK
RKVRTRSLSDFTGPPQLQALKYKDPASRRELELPSSKTEGPYGEISMLDTKVSVAQLRSA
FLASANACRRPELKSRVERSAEGPGLPTGVERERGSRKPRRYFSPGESRKTSERFRTQPI
TSAERKESDRCTSHSETPTVDDEEKVDERAKLSVAAKRLLFREMEKSFDEQNVPKRRSRN
TAVEQRLRRLQDRSLTQPITTEEVVIAATEPIPASCSGGTHPVMARLPSPTVARSAVQPA
RLQASAHQKALAKDQTNEGKELAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRID
TRQRRMNARYQTQPVTLGEVEQVQSGKLIPFSPAVNTSVSTVASTVAPMYAGDLRTKPPL
DHNASATDYKFSSSIENSDSPVRSILKSQAWQPLVEGSENKGMLREYGETESKRALTGRD
SGMEKYGSFEEAEASYPILNRAREGDSHKESKYAVPRRGSLERANPPITHLGDEPKEFSM
AKMNAQGNLDLRDRLPFEEKVEVENVMKRKFSLRAAEFGEPTSEQTGTAAGKTIAQTTAP
VSWKPQDSSEQPQEKLCKNPCAMFAAGEIKTPTGEGLLDSPSKTMSIKERLALLKKSGEE
DWRNRLSRRQEGGKAPASSLHTQEAGRSLIKKRVTESRESQMTIEERKQLITVREEAWKT
RGRGAANDSTQFTVAGRMVKKGLASPTAITPVASPICGKTRGTTPVSKPLEDIEARPDMQ
LESDLKLDRLETFLRRLNNKVGGMHETVLTVTGKSVKEVMKPDDDETFAKFYRSVDYNMP
RSPVEMDEDFDVIFDPYAPKLTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTE
QRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNSNNSAVPY
KRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELA
TLIQTKRELGCRATYIQTIEEGINTHTHAAKDFWKLLGGQTSYQSAGDPKEDELYEAAII
ETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAF
QLAKHLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFL
DWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVE
GHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGE
HSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQ
GGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKA
LIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALG
RRDRKAYDCMLQDPGSFNFAPRLFILSSSSGDFAATEFVYPARAPSVVSSMPFLQEDLYS
APQPALFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCKGKNLKKPA
PKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLA
DLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O46385	0.257	0.260	0.000	2194	0.836	0.844	O46385.pdb.gz	SVIL_BOVIN Supervillin OS=Bos taurus OX=9913 GN=SVIL PE=1 SV=2
2	AFDB:O95425	1.000	1.000	0.000	2214	1.000	1.000	O95425.pdb.gz	SVIL_HUMAN Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2
3	PDB:6jegB	0.093	0.256	2.378E-35	718	0.071	0.219	6jegB.pdb.gz
4	PDB:1j72A	0.046	0.280	5.100E-18	337	0.035	0.228	1j72A.pdb.gz
5	PDB:7cccB	0.045	0.234	9.934E-4	342	0.013	0.085	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
6	AFDB:Q380Z7	0.025	0.027	1.326E-3	2059	0.096	0.103	Q380Z7.pdb.gz	Q380Z7_TRYB2 Flagellar Member 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8650 PE=4 SV=1
7	AFDB:H2KYH3	0.029	0.027	1.400E-3	2476	0.111	0.099	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
8	AFDB:A2ALU4	0.026	0.034	1.939E-3	1481	0.092	0.137	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
9	AFDB:Q9GV71	0.049	0.066	2.161E-3	1543	0.077	0.110	Q9GV71.pdb.gz	Q9GV71_DICDI MAP kinase phosphatase OS=Dictyostelium discoideum OX=44689 GN=mkpA PE=4 SV=1
10	PDB:1cofA	0.034	0.400	3.656E-3	135	0.006	0.096	1cofA.pdb.gz
11	PDB:2mv2A	0.034	0.354	5.960E-3	148	0.008	0.115	2mv2A.pdb.gz
12	AFDB:Q8INM3	0.025	0.041	7.135E-3	1420	0.096	0.149	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
13	PDB:2i2qA	0.033	0.436	8.255E-3	122	0.006	0.107	2i2qA.pdb.gz
14	AFDB:Q9Y2W1	0.024	0.047	3.263E-2	955	0.068	0.158	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
15	AFDB:A0A0R4IS11	0.023	0.029	3.841E-2	1565	0.085	0.121	A0A0R4IS11.pdb.gz
16	AFDB:Q9W523	0.027	0.035	4.520E-2	1537	0.096	0.138	Q9W523.pdb.gz	Q9W523_DROME Polyhomeotic distal, isoform A OS=Drosophila melanogaster OX=7227 GN=ph-d PE=4 SV=3
17	PDB:7bk0B	0.028	0.133	4.953E-2	250	0.014	0.120	7bk0B.pdb.gz
18	PDB:1tvjA	0.036	0.394	5.230E-2	166	0.006	0.084	1tvjA.pdb.gz
19	PDB:5kynA	0.044	0.116	5.829E-2	730	0.010	0.032	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
20	PDB:1udmA	0.038	0.401	7.243E-2	149	0.005	0.081	1udmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PIX7	0.0	3346	1904	0.724	0.841	A0A6I8PIX7_HUMAN Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=1
2	O46385	0.0	3722	2194	0.837	0.845	SVIL_BOVIN Supervillin OS=Bos taurus OX=9913 GN=SVIL PE=1 SV=2
3	O95425	0.0	4591	2214	1.000	1.000	SVIL_HUMAN Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2
4	Q6U1J6	0.0	3477	2073	0.792	0.846	Q6U1J6_MUSPF Smooth muscle archvillin OS=Mustela putorius furo OX=9669 PE=1 SV=1
5	Q8WQ85	1.36e-68	259	1704	0.107	0.138	VILD_DICDI Villidin OS=Dictyostelium discoideum OX=44689 GN=vilA PE=1 SV=2
6	O75366	9.87e-45	179	819	0.097	0.263	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
7	Q62468	6.90e-44	176	827	0.093	0.250	VILI_MOUSE Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3
8	O88398	2.90e-42	171	819	0.096	0.260	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
9	P09327	5.64e-42	170	827	0.093	0.250	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
10	Q9WU06	1.41e-40	166	819	0.095	0.258	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
11	B4DV78	2.24e-38	154	516	0.072	0.308	B4DV78_HUMAN Villin 1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=1
12	P36418	1.20e-37	157	959	0.081	0.187	VILB_DICDI Protovillin OS=Dictyostelium discoideum OX=44689 GN=vilB PE=1 SV=1
13	G1U9R8	1.48e-33	143	739	0.075	0.225	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
14	O15195	2.54e-32	139	856	0.082	0.211	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
15	Q68FP1	4.14e-32	138	780	0.075	0.214	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
16	P13020	6.01e-32	138	780	0.074	0.210	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
17	P06396	2.00e-31	136	782	0.074	0.210	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
18	A0JMJ1	1.19e-29	130	720	0.079	0.242	A0JMJ1_DANRE Scinderin like a OS=Danio rerio OX=7955 GN=fb94b12 PE=1 SV=2
19	P20305	3.13e-29	129	772	0.072	0.207	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
20	E9PU64	7.66e-29	127	715	0.075	0.231	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15766 DUF4695	3.5e+02	12.8	Domain of unknown function (DUF4695)
2	PF00626 Gelsolin	9.7e-17	72.0	Gelsolin repeat
3	PF02209 VHP	1.6e-12	58.4	Villin headpiece domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348128

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378368	0.960	Flotillin-2
2	9606.ENSP00000383042	0.909	Lysine-specific histone demethylase 1A
3	9606.ENSP00000349960	0.902	Actin, cytoplasmic 1
4	9606.ENSP00000356319	0.873	Kinesin-like protein KIF14
5	9606.ENSP00000365569	0.868	Flotillin-1
6	9606.ENSP00000363822	0.859	Androgen receptor
7	9606.ENSP00000348215	0.838	SH3 and PX domain-containing protein 2A
8	9606.ENSP00000350052	0.782	POTE ankyrin domain family member F
9	9606.ENSP00000484342	0.782	Nebulin
10	9606.ENSP00000458162	0.779	Actin, cytoplasmic 2
11	9606.ENSP00000387176	0.777	POTE ankyrin domain family member J
12	9606.ENSP00000392718	0.777	POTE ankyrin domain family member I
13	9606.ENSP00000439189	0.777	POTE ankyrin domain family member E
14	9606.ENSP00000200457	0.722	Thyroid receptor-interacting protein 6
15	9606.ENSP00000358866	0.707	Filamin-A
16	9606.ENSP00000258787	0.684	Unconventional myosin-Ig
17	9606.ENSP00000211998	0.647	Vinculin
18	9606.ENSP00000274507	0.642	Leukocyte cell-derived chemotaxin-2
19	9606.ENSP00000286835	0.629	Splicing factor, arginine/serine-rich 15
20	9606.ENSP00000302530	0.628	Mitotic checkpoint serine/threonine-protein kinase BUB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	0.999	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.957	anatomical structure development
GO:0065007	0.908	biological regulation
GO:0050794	0.900	regulation of cellular process
GO:0009888	0.771	tissue development
GO:0009987	0.715	cellular process
GO:0061061	0.666	muscle structure development
GO:0060537	0.645	muscle tissue development
GO:0048513	0.601	animal organ development
GO:0060538	0.587	skeletal muscle organ development
GO:0048518	0.557	positive regulation of biological process
GO:0048522	0.524	positive regulation of cellular process
GO:0016043	0.446	cellular component organization
GO:0032501	0.433	multicellular organismal process
GO:0007519	0.410	skeletal muscle tissue development
GO:0006996	0.343	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005856	0.999	cytoskeleton
GO:0005829	0.998	cytosol
GO:0015629	0.973	actin cytoskeleton
GO:0070161	0.956	anchoring junction
GO:0030055	0.949	cell-substrate junction
GO:0043227	0.945	membrane-bounded organelle
GO:0099080	0.935	supramolecular complex
GO:0043231	0.916	intracellular membrane-bounded organelle
GO:0005925	0.883	focal adhesion
GO:0099512	0.862	supramolecular fiber
GO:0005634	0.735	nucleus
GO:0031982	0.714	vesicle
GO:0030016	0.611	myofibril
GO:0070013	0.447	intracellular organelle lumen
GO:0031981	0.383	nuclear lumen
GO:0043034	0.341	costamere
GO:0005654	0.317	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]