StarFunc result for job id O95428

User Input

>input (1278 residues)
MRLLLLVPLLLAPAPGSSAPKVRRQSDTWGPWSQWSPCSRTCGGGVSFRERPCYSQRRDG
GSSCVGPARSHRSCRTESCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYSAPNKCELNC
IPKGENFYYKHREAVVDGTPCEPGKRDVCVDGSCRVVGCDHELDSSKQEDKCLRCGGDGT
TCYPVAGTFDANDLSRGYNQILIVPMGATSILIDEAAASRNFLAVKNVRGEYYLNGHWTI
EAARALPAASTILHYERGAEGDLAPERLHARGPTSEPLVIELISQEPNPGVHYEYHLPLR
RPSPGFSWSHGSWSDCSAECGGGHQSRLVFCTIDHEAYPDHMCQRQPRPADRRSCNLHPC
PETKRWKAGPWAPCSASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACN
LQRCAAWSPEPWGECSVSCGVGVRKRSVTCRGERGSLLHTAACSLEDRPPLTEPCVHEDC
PLLSDQAWHVGTWGLCSKSCSSGTRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQPCHL
PQEVPSMQDVHTPASNPWMPLGPQESPASDSRGQWWAAQEHPSARGDHRGERGDPRGDQG
THLSALGPAPSLQQPPYQQPLRSGSGPHDCRHSPHGCCPDGHTASLGPQWQGCPGAPCQQ
SRYGCCPDRVSVAEGPHHAGCTKSYGGDSTGGMPRSRAVASTVHNTHQPQAQQNEPSECR
GSQFGCCYDNVATAAGPLGEGCVGQPSHAYPVRCLLPSAHGSCADWAARWYFVASVGQCN
RFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQPGASGRSTHTDGGGSSPAGEQEPSQ
HRTGAAVQRKPWPSGGLWRQDQQPGPGEAPHTQAFGEWPWGQELGSRAPGLGGDAGSPAP
PFHSSSYRISLAGVEPSLVQAALGQLVRLSCSDDTAPESQAAWQKDGQPISSDRHRLQFD
GSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDF
GQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEWQRD
GQPVSSPRHQLQPDGSLVISRVAVEDGGFYTCVAFNGQDRDQRWVQLRVLGELTISGLPP
TVTVPEGDTARLLCVVAGESVNIRWSRNGLPVQADGHRVHQSPDGTLLIYNLRARDEGSY
TCSAYQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCVDQPELANCDLILQAQLCGNEYYSS
FCCASCSRFQPHAQPIWQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EPX2	0.345	0.344	0.000	1280	0.746	0.745	Q9EPX2.pdb.gz	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
2	AFDB:O76840	0.199	0.120	2.132E-62	2167	0.298	0.176	O76840.pdb.gz	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
3	AFDB:D3Z1A5	0.202	0.230	5.001E-57	1117	0.157	0.180	D3Z1A5.pdb.gz	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
4	AFDB:Q68SA9	0.198	0.155	2.404E-52	1657	0.225	0.173	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
5	AFDB:Q9UKP4	0.202	0.155	8.742E-51	1686	0.235	0.178	Q9UKP4.pdb.gz	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
6	AFDB:Q811B3	0.195	0.157	5.392E-49	1600	0.211	0.169	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
7	AFDB:Q3UTY6	0.184	0.226	3.084E-48	1018	0.162	0.203	Q3UTY6.pdb.gz	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
8	AFDB:Q6ZMP0	0.179	0.220	7.347E-47	1018	0.161	0.202	Q6ZMP0.pdb.gz	THSD4_HUMAN Thrombospondin type-1 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=THSD4 PE=1 SV=2
9	AFDB:Q80T21	0.155	0.186	3.375E-44	1036	0.153	0.188	Q80T21.pdb.gz	ATL4_MOUSE ADAMTS-like protein 4 OS=Mus musculus OX=10090 GN=Adamtsl4 PE=2 SV=1
10	AFDB:Q7TSK7	0.204	0.268	3.250E-41	957	0.136	0.182	Q7TSK7.pdb.gz	ATL2_MOUSE ADAMTS-like protein 2 OS=Mus musculus OX=10090 GN=Adamtsl2 PE=1 SV=1
11	PDB:6dldD	0.099	0.350	1.088E-13	269	0.045	0.216	6dldD.pdb.gz
12	PDB:5oj2B	0.121	0.208	2.098E-12	692	0.052	0.097	5oj2B.pdb.gz
13	PDB:6dlfA	0.088	0.355	5.858E-11	236	0.043	0.233	6dlfA.pdb.gz
14	PDB:1w0rA	0.057	0.116	3.724E-10	442	0.067	0.195	1w0rA.pdb.gz
15	PDB:6feyB	0.073	0.418	3.613E-9	207	0.036	0.222	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
16	PDB:1e07A	0.088	0.144	5.231E-9	642	0.045	0.089	1e07A.pdb.gz
17	PDB:3o3uN	0.104	0.207	5.350E-8	580	0.031	0.067	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
18	PDB:5c6wJ	0.062	0.300	8.165E-8	238	0.038	0.206	5c6wJ.pdb.gz
19	PDB:1jnhA	0.084	0.318	1.063E-7	208	0.031	0.188	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
20	PDB:6feyD	0.069	0.527	1.063E-7	160	0.028	0.225	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EPX2	0.0	1898	1280	0.741	0.740	PPN_MOUSE Papilin OS=Mus musculus OX=10090 GN=Papln PE=2 SV=2
2	Q9UKP5	1.87e-104	359	1117	0.156	0.178	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
3	Q868Z9	3.74e-103	364	2898	0.159	0.070	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
4	D3Z1A5	9.37e-103	354	1117	0.157	0.180	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
5	Q4VC17	6.84e-101	351	1219	0.161	0.169	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
6	Q8TE60	7.57e-99	345	1221	0.153	0.161	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
7	E7FEJ5	9.08e-97	340	1244	0.158	0.162	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
8	D3ZLL7	3.46e-95	335	1221	0.153	0.161	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
9	Q9H324	8.35e-95	332	1103	0.157	0.182	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
10	Q69Z28	8.75e-94	330	1222	0.150	0.157	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
11	O76840	5.55e-87	315	2167	0.153	0.090	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
12	Q9UKP4	3.45e-85	308	1686	0.146	0.110	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
13	Q68SA9	2.06e-84	306	1657	0.146	0.113	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
14	Q811B3	4.53e-78	286	1600	0.135	0.108	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
15	E9PUN6	6.80e-78	286	1931	0.142	0.094	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
16	E9PYV8	1.46e-77	283	1350	0.142	0.134	E9PYV8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
17	E7FFX0	3.19e-77	281	1224	0.142	0.148	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
18	P58397	1.04e-76	282	1594	0.138	0.110	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
19	Q9P2N4	1.47e-76	282	1935	0.144	0.095	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
20	F1SFS3	9.85e-76	279	2000	0.138	0.088	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19236 ADAMTS_CR_3	2.6e-08	45.3	ADAMTS cysteine-rich domain
2	PF05986 ADAMTS_spacer1	4.4e-26	102.8	ADAM-TS Spacer 1
3	PF07654 C1-set	1.2	20.9	Immunoglobulin C1-set domain
4	PF08205 C2-set_2	0.00046	31.5	CD80-like C2-set immunoglobulin domain
5	PF07679 I-set	3.4e-38	140.9	Immunoglobulin I-set domain
6	PF00047 ig	1.1e-23	94.5	Immunoglobulin domain
7	PF13895 Ig_2	1.4e-25	100.8	Immunoglobulin domain
8	PF13927 Ig_3	1.5e-36	136.1	Immunoglobulin domain
9	PF16681 Ig_5	4.3e-05	35.2	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF16706 Izumo-Ig	3.3e+02	12.6	Izumo-like Immunoglobulin domain
11	PF00014 Kunitz_BPTI	3e-14	64.3	Kunitz/Bovine pancreatic trypsin inhibitor domain
12	PF16626 Papilin_u7	4.5e-40	147.5	Linking region between Kunitz_BPTI and I-set on papilin
13	PF08686 PLAC	1.3e-06	40.4	PLAC (protease and lacunin) domain
14	PF01034 Syndecan	8.1e+02	11.4	Syndecan domain
15	PF19030 TSP1_ADAMTS	1.6e-44	161.3	Thrombospondin type 1 domain
16	PF19035 TSP1_CCN	6e-05	34.6	CCN3 Nov like TSP1 domain
17	PF19028 TSP1_spondin	3.5e-06	38.6	Spondin-like TSP1 domain
18	PF00090 TSP_1	2.4e-28	109.4	Thrombospondin type 1 domain
19	PF07686 V-set	8.2e-21	85.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345395

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231061	0.906	SPARC
2	9606.ENSP00000280346	0.793	Dihydrolipoamide S-acetyltransferase
3	9606.ENSP00000324343	0.793	Beta-ureidopropionase
4	9606.ENSP00000335304	0.788	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
5	9606.ENSP00000373620	0.761	60 kDa heat shock protein, mitochondrial
6	9606.ENSP00000219313	0.760	26S proteasome non-ATPase regulatory subunit 7
7	9606.ENSP00000350719	0.745	Nesprin-2
8	9606.ENSP00000356224	0.745	Nesprin-1
9	9606.ENSP00000324173	0.669	78 kDa glucose-regulated protein
10	9606.ENSP00000440374	0.607	Guanine nucleotide exchange factor DBS
11	9606.ENSP00000463154	0.604	Acidic leucine-rich nuclear phosphoprotein 32 family member E
12	9606.ENSP00000264187	0.561	Nidogen-1
13	9606.ENSP00000258613	0.541	Thrombospondin type-1 domain-containing protein 1
14	9606.ENSP00000325527	0.538	Fibrillin-1
15	9606.ENSP00000262746	0.533	Peroxiredoxin-1
16	9606.ENSP00000298510	0.533	Thioredoxin-dependent peroxide reductase, mitochondrial
17	9606.ENSP00000301522	0.533	Peroxiredoxin-2
18	9606.ENSP00000216286	0.515	Nidogen-2
19	9606.ENSP00000265806	0.505	R3H domain and coiled-coil containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.699	identical protein binding
GO:0003824	0.552	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0008152	0.961	metabolic process
GO:0071704	0.860	organic substance metabolic process
GO:0065007	0.748	biological regulation
GO:0050789	0.716	regulation of biological process
GO:0050794	0.699	regulation of cellular process
GO:0044238	0.657	primary metabolic process
GO:0006807	0.537	nitrogen compound metabolic process
GO:0071840	0.533	cellular component organization or biogenesis
GO:0016043	0.505	cellular component organization
GO:0050896	0.488	response to stimulus
GO:1901564	0.401	organonitrogen compound metabolic process
GO:0032502	0.391	developmental process
GO:0048856	0.345	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.997	collagen-containing extracellular matrix
GO:0043226	0.943	organelle
GO:0043229	0.931	intracellular organelle
GO:0043227	0.926	membrane-bounded organelle
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0005737	0.905	cytoplasm
GO:0043233	0.905	organelle lumen
GO:0070013	0.903	intracellular organelle lumen
GO:0012505	0.891	endomembrane system
GO:0005576	0.780	extracellular region
GO:0005604	0.653	basement membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]