StarFunc result for job id O95429

User Input

>input (457 residues)
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAET
TWLGEGGGGDGYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVR
PELQGQSLNSYTNGAYGPTYPPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSP
TPVSRWIYPQQDCQTEAPPLRGQVPGYPPSQNPGMTLPHYPYGDGNRSVPQSGPTVRPQE
DAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPSSGSPQSPPSPPVQQPKDSSY
PYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQD
QSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL
LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95429	0.999	0.999	1.029E-54	457	1.000	1.000	O95429.pdb.gz	BAG4_HUMAN BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 PE=1 SV=1
2	AFDB:Q5XIR5	0.338	0.338	2.498E-44	457	0.860	0.860	Q5XIR5.pdb.gz	Q5XIR5_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
3	AFDB:O95817	0.199	0.162	2.356E-9	575	0.252	0.200	O95817.pdb.gz	BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3
4	AFDB:Q68CQ1	0.072	0.030	2.218E-1	1323	0.160	0.055	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
5	PDB:2jmhA	0.123	0.343	2.324E-1	117	0.035	0.137	2jmhA.pdb.gz
6	PDB:5ynxA	0.124	0.377	3.232E-1	117	0.037	0.145	5ynxA.pdb.gz
7	PDB:4kddA	0.061	0.133	5.601E-1	184	0.033	0.082	4kddA.pdb.gz	Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
8	AFDB:Q9FJX6	0.089	0.058	7.036E-1	899	0.225	0.115	Q9FJX6.pdb.gz	FH6_ARATH Formin-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=FH6 PE=2 SV=1
9	AFDB:Q8NEC5	0.083	0.054	9.262E-1	780	0.144	0.085	Q8NEC5.pdb.gz	CTSR1_HUMAN Cation channel sperm-associated protein 1 OS=Homo sapiens OX=9606 GN=CATSPER1 PE=1 SV=3
10	AFDB:B8PWL7	0.080	0.039	9.785E-1	994	0.206	0.095	B8PWL7.pdb.gz	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1
11	AFDB:Q86SQ0	0.088	0.041	1.034	1253	0.190	0.069	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
12	PDB:4x3nA	0.118	0.185	1.083	259	0.035	0.062	4x3nA.pdb.gz	Structure of the 34 kDa F-actin-bundling protein ABP34 from Dictyostelium discoideum.
13	PDB:3u8vA	0.097	0.428	1.209	83	0.024	0.133	3u8vA.pdb.gz
14	PDB:1ek8A	0.064	0.141	1.426	185	0.026	0.065	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
15	PDB:7qwsK	0.094	0.099	1.506	426	0.031	0.033	7qwsK.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
16	AFDB:Q587H5	0.081	0.027	1.605	1501	0.173	0.053	Q587H5.pdb.gz	Q587H5_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.160 PE=4 SV=1
17	PDB:7khsA	0.082	0.084	1.777	449	0.022	0.022	7khsA.pdb.gz	Diazaspirononane Nonsaccharide Inhibitors of O-GlcNAcase (OGA) for the Treatment of Neurodegenerative Disorders.
18	AFDB:O00268	0.090	0.046	1.893	1085	0.208	0.088	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
19	PDB:3pjaL	0.133	0.243	1.983	223	0.024	0.049	3pjaL.pdb.gz
20	PDB:7khsC	0.082	0.088	2.339	427	0.022	0.023	7khsC.pdb.gz	Diazaspirononane Nonsaccharide Inhibitors of O-GlcNAcase (OGA) for the Treatment of Neurodegenerative Disorders.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AP78	0.0	586	457	0.801	0.801	A0A8I6AP78_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
2	O95429	0.0	907	457	1.000	1.000	BAG4_HUMAN BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 PE=1 SV=1
3	Q5XIR5	0.0	654	457	0.860	0.860	Q5XIR5_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
4	Q8CI61	0.0	609	457	0.832	0.832	BAG4_MOUSE BAG family molecular chaperone regulator 4 OS=Mus musculus OX=10090 GN=Bag4 PE=1 SV=2
5	O95817	6.54e-22	100	575	0.103	0.082	BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3
6	Q9JLV1	1.74e-21	99.4	577	0.103	0.081	BAG3_MOUSE BAG family molecular chaperone regulator 3 OS=Mus musculus OX=10090 GN=Bag3 PE=1 SV=2
7	Q6DC38	4.23e-18	88.6	459	0.107	0.107	Q6DC38_DANRE BAG family molecular chaperone regulator 3 OS=Danio rerio OX=7955 GN=zgc:100859 PE=2 SV=1
8	A8JNS4	3.79e-15	80.1	635	0.081	0.058	A8JNS4_DROME Starvin, isoform E OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
9	M9PCD9	4.23e-15	80.1	610	0.081	0.061	M9PCD9_DROME Starvin, isoform F OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
10	Q9VU81	4.30e-15	79.7	609	0.081	0.061	Q9VU81_DROME GH02003p OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=2
11	Q9BLJ6	4.32e-15	80.1	677	0.077	0.052	BAGS_BOMMO BAG domain-containing protein Samui OS=Bombyx mori OX=7091 GN=Samui PE=2 SV=1
12	Q9VU82	7.94e-15	79.0	542	0.083	0.070	Q9VU82_DROME Starvin, isoform C OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
13	Q9VU83	1.09e-14	78.6	516	0.083	0.074	Q9VU83_DROME Starvin, isoform B OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
14	Q5QJC9	6.28e-08	57.0	447	0.070	0.072	BAG5_RAT BAG family molecular chaperone regulator 5 OS=Rattus norvegicus OX=10116 GN=Bag5 PE=1 SV=1
15	Q9UL15	1.17e-07	56.2	447	0.070	0.072	BAG5_HUMAN BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1
16	Q8CI32	1.19e-06	53.1	447	0.068	0.069	BAG5_MOUSE BAG family molecular chaperone regulator 5 OS=Mus musculus OX=10090 GN=Bag5 PE=1 SV=1
17	E7EU81	0.83	34.7	3223	0.081	0.011	E7EU81_HUMAN Golgin B1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2
18	Q14789	0.83	34.7	3259	0.081	0.011	GOGB1_HUMAN Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2
19	Q90788	6.9	31.2	294	0.044	0.068	NKX25_CHICK Homeobox protein Nkx-2.5 OS=Gallus gallus OX=9031 GN=NKX-2.5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02179 BAG	6.4e-14	63.6	BAG domain
2	PF16779 DMP12	5.6e+02	11.9	DNA-mimic protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.997	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000302961	0.995	Heat shock protein family A member 4
3	9606.ENSP00000432083	0.979	Heat shock cognate 71 kDa protein
4	9606.ENSP00000364805	0.966	Heat shock 70 kDa protein 1-like
5	9606.ENSP00000364802	0.961	Heat shock 70 kDa protein 1A
6	9606.ENSP00000341268	0.954	Tumor necrosis factor receptor type 1-associated DEATH domain protein
7	9606.ENSP00000364801	0.954	Heat shock protein family A member 1B
8	9606.ENSP00000285667	0.949	Heat shock 70 kDa protein 13
9	9606.ENSP00000378199	0.949	Heat shock-related 70 kDa protein 2
10	9606.ENSP00000367623	0.945	Heat shock 70 kDa protein 14
11	9606.ENSP00000297185	0.935	Stress-70 protein, mitochondrial
12	9606.ENSP00000358211	0.933	Heat shock protein family A member 12A
13	9606.ENSP00000324173	0.931	78 kDa glucose-regulated protein
14	9606.ENSP00000254963	0.929	Heat shock protein family A member 12B
15	9606.ENSP00000301838	0.929	FAS-associated death domain protein
16	9606.ENSP00000310219	0.928	Heat shock 70 kDa protein 6
17	9606.ENSP00000398698	0.927	Tumor necrosis factor
18	9606.ENSP00000407586	0.927	GTPase HRas
19	9606.ENSP00000296464	0.922	Heat shock 70 kDa protein 4L
20	9606.ENSP00000312664	0.919	Caspase-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.977	enzyme binding
GO:1901363	0.962	heterocyclic compound binding
GO:0097159	0.962	organic cyclic compound binding
GO:0003676	0.891	nucleic acid binding
GO:0031625	0.891	ubiquitin protein ligase binding
GO:0003723	0.834	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0050896	0.979	response to stimulus
GO:0048519	0.968	negative regulation of biological process
GO:0048523	0.956	negative regulation of cellular process
GO:0019222	0.907	regulation of metabolic process
GO:0060255	0.876	regulation of macromolecule metabolic process
GO:0051716	0.854	cellular response to stimulus
GO:0051171	0.685	regulation of nitrogen compound metabolic process
GO:0080090	0.679	regulation of primary metabolic process
GO:0031323	0.654	regulation of cellular metabolic process
GO:0042221	0.635	response to chemical
GO:0010033	0.633	response to organic substance
GO:0010941	0.626	regulation of cell death
GO:0048518	0.591	positive regulation of biological process
GO:0043067	0.529	regulation of programmed cell death
GO:0042981	0.524	regulation of apoptotic process
GO:0048522	0.516	positive regulation of cellular process
GO:0010604	0.387	positive regulation of macromolecule metabolic process
GO:0071310	0.372	cellular response to organic substance
GO:0009892	0.371	negative regulation of metabolic process
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0048583	0.323	regulation of response to stimulus
GO:0019219	0.318	regulation of nucleobase-containing compound metabolic process
GO:0060548	0.314	negative regulation of cell death
GO:0031324	0.313	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005886	0.994	plasma membrane
GO:0005829	0.993	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]