StarFunc result for job id O95445

User Input

>input (188 residues)
MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEEL
ATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMK
TELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQ
EACELSNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95445	1.000	1.000	5.189E-36	188	1.000	1.000	O95445.pdb.gz	APOM_HUMAN Apolipoprotein M OS=Homo sapiens OX=9606 GN=APOM PE=1 SV=2
2	AFDB:P14630	0.935	0.926	3.221E-29	190	0.824	0.816	P14630.pdb.gz	APOM_RAT Apolipoprotein M OS=Rattus norvegicus OX=10116 GN=Apom PE=1 SV=2
3	PDB:3kq0A	0.678	0.723	2.102E-8	175	0.128	0.137	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
4	PDB:3apxA	0.581	0.608	2.608E-8	179	0.117	0.123	3apxA.pdb.gz	Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms.
5	AFDB:Q9I9P7	0.636	0.667	2.665E-8	178	0.165	0.174	Q9I9P7.pdb.gz	EXFAB_COTJA Extracellular fatty acid-binding protein OS=Coturnix japonica OX=93934 PE=1 SV=1
6	AFDB:A0A1D5NW85	0.652	0.683	6.318E-8	178	0.149	0.157	A0A1D5NW85.pdb.gz	A0A1D5NW85_CHICK Extracellular fatty acid-binding protein OS=Gallus gallus OX=9031 GN=EXFABP PE=1 SV=1
7	AFDB:P02763	0.613	0.576	2.184E-7	201	0.138	0.129	P02763.pdb.gz	A1AG1_HUMAN Alpha-1-acid glycoprotein 1 OS=Homo sapiens OX=9606 GN=ORM1 PE=1 SV=2
8	AFDB:Q64240	0.650	0.372	2.305E-7	349	0.106	0.057	Q64240.pdb.gz	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
9	AFDB:P31025	0.621	0.658	3.186E-7	176	0.138	0.148	P31025.pdb.gz	LCN1_HUMAN Lipocalin-1 OS=Homo sapiens OX=9606 GN=LCN1 PE=1 SV=1
10	PDB:2kt4B	0.607	0.710	4.083E-7	157	0.144	0.172	2kt4B.pdb.gz	The v-myc-induced Q83 lipocalin is a siderocalin.
11	AFDB:Q07456	0.640	0.369	6.087E-7	349	0.128	0.069	Q07456.pdb.gz	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
12	PDB:3saoA	0.597	0.730	7.002E-7	150	0.117	0.147	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
13	AFDB:P02764	0.626	0.579	8.412E-7	205	0.101	0.093	P02764.pdb.gz	A1AG_RAT Alpha-1-acid glycoprotein OS=Rattus norvegicus OX=10116 GN=Orm1 PE=2 SV=1
14	AFDB:Q62471	0.608	0.625	9.890E-7	182	0.181	0.187	Q62471.pdb.gz	VNS1_MOUSE Vomeronasal secretory protein 1 OS=Mus musculus OX=10090 GN=Lcn3 PE=2 SV=2
15	PDB:4runB	0.578	0.698	2.173E-6	152	0.165	0.204	4runB.pdb.gz
16	PDB:5t43A	0.588	0.680	2.555E-6	158	0.138	0.165	5t43A.pdb.gz
17	PDB:2qosC	0.648	0.697	4.381E-6	173	0.106	0.116	2qosC.pdb.gz	Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
18	PDB:4gh7A	0.572	0.613	1.687E-5	174	0.112	0.121	4gh7A.pdb.gz
19	PDB:3o2yA	0.591	0.680	2.210E-5	160	0.138	0.163	3o2yA.pdb.gz
20	PDB:1epbB	0.535	0.604	4.000E-5	164	0.144	0.165	1epbB.pdb.gz	Structure of the epididymal retinoic acid binding protein at 2.1 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95445	3.79e-143	397	188	1.000	1.000	APOM_HUMAN Apolipoprotein M OS=Homo sapiens OX=9606 GN=APOM PE=1 SV=2
2	Q9Z1R3	2.42e-113	322	190	0.814	0.805	APOM_MOUSE Apolipoprotein M OS=Mus musculus OX=10090 GN=Apom PE=1 SV=1
3	P14630	1.65e-107	307	190	0.824	0.816	APOM_RAT Apolipoprotein M OS=Rattus norvegicus OX=10116 GN=Apom PE=1 SV=2
4	Q4Q3L0	3.5	30.8	949	0.128	0.025	Q4Q3L0_LEIMA ABC transporter family-like protein OS=Leishmania major OX=5664 GN=LMJF_33_3260 PE=4 SV=1
5	P84743	4.6	30.4	859	0.096	0.021	PBLST_EUGGR Photoactivated adenylate cyclase subunit beta-like protein ST- OS=Euglena gracilis OX=3039 GN=pacB PE=2 SV=1
6	Q9VXB5	5.4	29.6	233	0.090	0.073	RM22_DROME Large ribosomal subunit protein uL22m OS=Drosophila melanogaster OX=7227 GN=mRpL22 PE=2 SV=2
7	G5EFK7	9.7	29.6	3310	0.170	0.010	G5EFK7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=2
8	G5ECP9	9.8	29.3	3424	0.170	0.009	G5ECP9_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=1 SV=1
9	Q86NF9	9.8	29.3	3436	0.170	0.009	Q86NF9_CAEEL VAB-10A protein OS=Caenorhabditis elegans OX=6239 GN=vab-10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11032 ApoM	1.5e-101	349.3	ApoM domain
2	PF00061 Lipocalin	1.4e+02	14.1	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236850	0.958	Apolipoprotein A-I
2	9606.ENSP00000321334	0.957	Apolipoprotein(a)
3	9606.ENSP00000365071	0.950	G-patch domain and ankyrin repeats 1
4	9606.ENSP00000466775	0.950	Apolipoprotein C-II
5	9606.ENSP00000306099	0.931	Fibrinogen beta chain
6	9606.ENSP00000356969	0.918	Apolipoprotein A-II
7	9606.ENSP00000252486	0.911	Apolipoprotein E
8	9606.ENSP00000233242	0.909	Apolipoprotein B-100
9	9606.ENSP00000227667	0.908	Apolipoprotein C-III
10	9606.ENSP00000222381	0.902	Serum paraoxonase/arylesterase 1
11	9606.ENSP00000465356	0.899	Apolipoprotein C-I
12	9606.ENSP00000317674	0.898	Apolipoprotein L1
13	9606.ENSP00000350425	0.890	Apolipoprotein A-IV
14	9606.ENSP00000200676	0.887	Cholesteryl ester transfer protein
15	9606.ENSP00000264005	0.886	Phosphatidylcholine-sterol acyltransferase
16	9606.ENSP00000468236	0.881	Apolipoprotein C-IV
17	9606.ENSP00000417138	0.879	Phospholipid transfer protein
18	9606.ENSP00000205948	0.872	Beta-2-glycoprotein 1
19	9606.ENSP00000445002	0.868	Apolipoprotein A-V
20	9606.ENSP00000315130	0.855	Clusterin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016209	1.000	antioxidant activity
GO:0005319	1.000	lipid transporter activity
GO:0005543	1.000	phospholipid binding
GO:0005515	0.981	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0032501	0.976	multicellular organismal process
GO:0015850	0.962	organic hydroxy compound transport
GO:0051128	0.952	regulation of cellular component organization
GO:0043933	0.948	protein-containing complex organization
GO:0006869	0.948	lipid transport
GO:0048519	0.941	negative regulation of biological process
GO:0015918	0.940	sterol transport
GO:0097006	0.939	regulation of plasma lipoprotein particle levels
GO:0071827	0.934	plasma lipoprotein particle organization
GO:0030301	0.924	cholesterol transport
GO:0048523	0.871	negative regulation of cellular process
GO:0055092	0.860	sterol homeostasis
GO:0042632	0.845	cholesterol homeostasis
GO:0051239	0.758	regulation of multicellular organismal process
GO:0050896	0.697	response to stimulus
GO:0051241	0.654	negative regulation of multicellular organismal process
GO:0008152	0.625	metabolic process
GO:0071704	0.584	organic substance metabolic process
GO:0044238	0.546	primary metabolic process
GO:0051129	0.537	negative regulation of cellular component organization
GO:0006807	0.317	nitrogen compound metabolic process
GO:0042221	0.312	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0032991	0.997	protein-containing complex
GO:0032994	0.990	protein-lipid complex
GO:0034358	0.983	plasma lipoprotein particle
GO:0034364	0.971	high-density lipoprotein particle
GO:0012505	0.944	endomembrane system
GO:0031982	0.920	vesicle
GO:0034361	0.861	very-low-density lipoprotein particle
GO:0005622	0.845	intracellular anatomical structure
GO:0005737	0.844	cytoplasm
GO:0016020	0.843	membrane
GO:0043231	0.834	intracellular membrane-bounded organelle
GO:0070013	0.523	intracellular organelle lumen
GO:0071944	0.494	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]