StarFunc result for job id O95450

User Input

>input (1211 residues)
MDPPAGAARRLLCPALLLLLLLLPPPLLPPPPPPANARLAAAADPPGGPLGHGAERILAV
PVRTDAQGRLVSHVVSAATSRAGVRARRAAPVRTPSFPGGNEEEPGSHLFYNVTVFGRDL
HLRLRPNARLVAPGATMEWQGEKGTTRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAG
LIRMEEEEFFIEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLS
RALGVLEEHANSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNE
IYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYH
DHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDG
QGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQ
LPGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCA
PGKHCFKGHCIWLTPDILKRDGSWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTC
SGLAYDFQLCSRQDCPDSLADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCE
SRETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNS
HCKVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHLAVKNLETGKFILNEEND
VDASSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPVGDTRVSLTYKYMIHEDS
LNVDDNNVLEEDSVVYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSK
PKAIRRACNPQECSQPVWVTGEWEPCSQTCGRTGMQVRSVRCIQPLHDNTTRSVHAKHCN
DARPESRRACSRELCPGRWRAGPWSQCSVTCGNGTQERPVLCRTADDSFGICQEERPETA
RTCRLGPCPRNISDPSKKSYVVQWLSRPDPDSPIRKISSKGHCQGDKSIFCRMEVLSRYC
SIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPL
EVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELID
EMRKKEMLGKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95450	0.999	0.999	0.000	1211	1.000	1.000	O95450.pdb.gz	ATS2_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Homo sapiens OX=9606 GN=ADAMTS2 PE=2 SV=2
2	AFDB:Q8C9W3	0.346	0.346	0.000	1213	0.884	0.883	Q8C9W3.pdb.gz	ATS2_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Mus musculus OX=10090 GN=Adamts2 PE=1 SV=2
3	AFDB:Q4VC17	0.224	0.222	1.265E-90	1219	0.280	0.278	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
4	AFDB:Q69Z28	0.223	0.221	2.868E-90	1222	0.271	0.268	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
5	AFDB:Q9H324	0.220	0.238	5.654E-87	1103	0.277	0.304	Q9H324.pdb.gz	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
6	AFDB:Q9P2N4	0.221	0.148	2.053E-84	1935	0.263	0.164	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
7	AFDB:P59510	0.231	0.156	9.995E-84	1910	0.257	0.163	P59510.pdb.gz	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
8	AFDB:P59511	0.227	0.153	1.822E-83	1906	0.254	0.162	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
9	AFDB:Q7TSK7	0.193	0.238	6.967E-38	957	0.132	0.167	Q7TSK7.pdb.gz	ATL2_MOUSE ADAMTS-like protein 2 OS=Mus musculus OX=10090 GN=Adamtsl2 PE=1 SV=1
10	AFDB:Q86TH1	0.194	0.241	1.416E-37	951	0.135	0.172	Q86TH1.pdb.gz	ATL2_HUMAN ADAMTS-like protein 2 OS=Homo sapiens OX=9606 GN=ADAMTSL2 PE=1 SV=1
11	PDB:4q1lA	0.147	0.818	3.837E-13	202	0.047	0.282	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.057	0.125	2.804E-9	442	0.073	0.199	1w0rA.pdb.gz
13	PDB:4a5wB	0.037	0.047	4.354E-4	871	0.022	0.031	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
14	PDB:6oj0Z	0.063	0.312	5.129E-4	180	0.020	0.133	6oj0Z.pdb.gz
15	PDB:7nycC	0.042	0.062	6.041E-4	809	0.031	0.047	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:3t5oA	0.039	0.050	6.738E-4	871	0.024	0.033	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:8a7eC	0.119	0.099	8.382E-4	1524	0.114	0.091	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:7nydE	0.056	0.117	8.852E-4	484	0.051	0.128	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:4e0sB	0.035	0.045	1.297E-3	898	0.030	0.040	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
20	PDB:7nydG	0.044	0.100	5.980E-3	413	0.037	0.109	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RXR8	0.0	1210	1206	0.505	0.507	B2RXR8_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=2 SV=1
2	B2RXX5	0.0	1211	1206	0.503	0.505	B2RXX5_MOUSE A Disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=1 SV=1
3	B2RY45	0.0	1337	1204	0.533	0.536	B2RY45_MOUSE Adamts3 protein OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
4	B2RY57	0.0	1360	1203	0.540	0.544	B2RY57_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
5	E9PX39	0.0	1224	1209	0.505	0.506	E9PX39_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=1 SV=1
6	E9Q287	0.0	1337	1204	0.533	0.536	E9Q287_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
7	G3X9D2	0.0	1360	1203	0.540	0.544	G3X9D2_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
8	O15072	0.0	1364	1205	0.542	0.544	ATS3_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 3 OS=Homo sapiens OX=9606 GN=ADAMTS3 PE=1 SV=4
9	O95450	0.0	2515	1211	1.000	1.000	ATS2_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Homo sapiens OX=9606 GN=ADAMTS2 PE=2 SV=2
10	P79331	0.0	2247	1205	0.884	0.889	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1
11	Q8C9W3	0.0	2159	1213	0.884	0.883	ATS2_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Mus musculus OX=10090 GN=Adamts2 PE=1 SV=2
12	Q8WXS8	0.0	1210	1223	0.515	0.510	ATS14_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 14 OS=Homo sapiens OX=9606 GN=ADAMTS14 PE=2 SV=2
13	D3Z1A5	2.13e-167	528	1117	0.288	0.312	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
14	Q9UKP5	4.16e-164	520	1117	0.284	0.308	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
15	Q8TE60	3.97e-154	496	1221	0.282	0.280	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
16	E7FEJ5	2.46e-152	491	1244	0.279	0.272	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
17	Q4VC17	1.18e-151	489	1219	0.284	0.282	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
18	Q68SA9	5.42e-149	491	1657	0.274	0.200	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
19	Q9H324	3.02e-146	471	1103	0.277	0.304	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
20	D3ZLL7	9.56e-146	473	1221	0.266	0.264	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	3.1e-14	64.5	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	4.1e-07	41.4	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	6.7e-25	99.0	ADAM-TS Spacer 1
4	PF16313 DUF4953	2.8e+02	12.1	Met-zincin
5	PF00413 Peptidase_M10	13	17.0	Matrixin
6	PF01562 Pep_M12B_propep	6.1e-32	122.3	Reprolysin family propeptide
7	PF08686 PLAC	1.6e+02	14.5	PLAC (protease and lacunin) domain
8	PF01421 Reprolysin	6.2e-16	70.5	Reprolysin (M12B) family zinc metalloprotease
9	PF13574 Reprolysin_2	5.4e-06	38.0	Metallo-peptidase family M12B Reprolysin-like
10	PF13582 Reprolysin_3	2e-07	42.9	Metallo-peptidase family M12B Reprolysin-like
11	PF13583 Reprolysin_4	0.012	26.8	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	1.1e-10	53.5	Metallo-peptidase family M12
13	PF19030 TSP1_ADAMTS	1.9e-27	106.6	Thrombospondin type 1 domain
14	PF19035 TSP1_CCN	2	20.2	CCN3 Nov like TSP1 domain
15	PF19028 TSP1_spondin	0.00015	33.3	Spondin-like TSP1 domain
16	PF00090 TSP_1	1.2e-18	78.3	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251582

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364000	0.982	Collagen alpha-2(V) chain
2	9606.ENSP00000297268	0.977	Collagen alpha-2(I) chain
3	9606.ENSP00000360882	0.972	Collagen alpha-1(V) chain
4	9606.ENSP00000225964	0.970	Collagen alpha-1(I) chain
5	9606.ENSP00000304408	0.967	Collagen alpha-1(III) chain
6	9606.ENSP00000343002	0.953	Beta-1,3-glucosyltransferase
7	9606.ENSP00000247153	0.952	Properdin
8	9606.ENSP00000348385	0.949	Collagen alpha-1(XXVII) chain
9	9606.ENSP00000359114	0.946	Collagen alpha-1(XI) chain
10	9606.ENSP00000369889	0.945	Collagen alpha-1(II) chain
11	9606.ENSP00000264828	0.934	Collagen alpha-3(V) chain
12	9606.ENSP00000346478	0.930	ADAMTS-like protein 2
13	9606.ENSP00000260356	0.929	Thrombospondin-1
14	9606.ENSP00000358035	0.929	ADAMTS-like protein 4
15	9606.ENSP00000355751	0.926	Thrombospondin-2
16	9606.ENSP00000359603	0.926	Collagen alpha-1(XXIV) chain
17	9606.ENSP00000360997	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 13
18	9606.ENSP00000284987	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 5
19	9606.ENSP00000339613	0.923	GDP-fucose protein O-fucosyltransferase 2
20	9606.ENSP00000422554	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	0.999	metallopeptidase activity
GO:0004175	0.994	endopeptidase activity
GO:0004222	0.984	metalloendopeptidase activity
GO:0005488	0.913	binding
GO:0005515	0.780	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0030198	0.938	extracellular matrix organization
GO:0030199	0.830	collagen fibril organization
GO:1901564	0.641	organonitrogen compound metabolic process
GO:0044238	0.588	primary metabolic process
GO:0043170	0.484	macromolecule metabolic process
GO:0019538	0.468	protein metabolic process
GO:0032501	0.428	multicellular organismal process
GO:0050789	0.380	regulation of biological process
GO:0048856	0.368	anatomical structure development
GO:0050794	0.341	regulation of cellular process
GO:0006508	0.313	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.987	cell periphery
GO:0031012	0.938	extracellular matrix
GO:0062023	0.866	collagen-containing extracellular matrix
GO:0043227	0.807	membrane-bounded organelle
GO:0012505	0.507	endomembrane system
GO:0070013	0.498	intracellular organelle lumen
GO:0043231	0.413	intracellular membrane-bounded organelle
GO:0005737	0.326	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.984	Metalloendopeptidases.

[back to server]