StarFunc result for job id O95453

User Input

>input (639 residues)
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKH
SMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQG
FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKF
IDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIV
ISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQF
YCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKV
ESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFN
KLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTS
AFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLN
PQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEP
LSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C0W0	0.853	0.822	0.000	664	1.000	0.962	A0A494C0W0.pdb.gz	A0A494C0W0_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
2	AFDB:O95453	1.000	1.000	0.000	639	1.000	1.000	O95453.pdb.gz	PARN_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
3	AFDB:A0A0G2QC45	0.835	0.855	8.214E-100	624	0.862	0.883	A0A0G2QC45.pdb.gz	A0A0G2QC45_RAT Poly(A)-specific ribonuclease PARN OS=Rattus norvegicus OX=10116 GN=Parn PE=2 SV=1
4	AFDB:A0A494C0Q6	0.637	0.700	6.107E-89	581	0.908	0.998	A0A494C0Q6.pdb.gz	A0A494C0Q6_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
5	AFDB:Q7ZU92	0.806	0.781	1.940E-87	660	0.659	0.638	Q7ZU92.pdb.gz	PARN_DANRE Poly(A)-specific ribonuclease PARN OS=Danio rerio OX=7955 GN=parn PE=1 SV=2
6	AFDB:Q8NA58	0.535	0.646	8.517E-33	520	0.203	0.250	Q8NA58.pdb.gz	PNDC1_HUMAN Poly(A)-specific ribonuclease PNLDC1 OS=Homo sapiens OX=9606 GN=PNLDC1 PE=1 SV=2
7	AFDB:Q57W87	0.532	0.574	2.697E-32	586	0.194	0.212	Q57W87.pdb.gz	Q57W87_TRYB2 Ribonuclease, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.230 PE=3 SV=1
8	AFDB:Q21412	0.518	0.578	5.228E-31	566	0.189	0.214	Q21412.pdb.gz	PARN1_CAEEL 3'-5' exoribonuclease parn-1 OS=Caenorhabditis elegans OX=6239 GN=parn-1 PE=1 SV=2
9	AFDB:Q38AC8	0.470	0.578	1.417E-27	509	0.180	0.226	Q38AC8.pdb.gz	Q38AC8_TRYB2 Ribonuclease, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2130 PE=3 SV=1
10	AFDB:Q8W4C3	0.504	0.520	5.008E-27	618	0.172	0.178	Q8W4C3.pdb.gz	PARNL_ARATH Poly(A)-specific ribonuclease PARN-like OS=Arabidopsis thaliana OX=3702 GN=At3g25430 PE=2 SV=1
11	PDB:2p51A	0.308	0.724	2.872E-8	255	0.091	0.227	2p51A.pdb.gz	The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
12	PDB:4gmjB	0.316	0.730	1.491E-7	264	0.091	0.220	4gmjB.pdb.gz	The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
13	PDB:3v9xB	0.199	0.538	7.390E-4	212	0.074	0.222	3v9xB.pdb.gz	How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
14	PDB:3lqvB	0.107	0.510	5.332E-3	115	0.038	0.209	3lqvB.pdb.gz	Branch Recognition by SF3b14
15	PDB:5xjcw	0.102	0.626	3.089E-2	91	0.022	0.154	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:6ff7X	0.093	0.311	3.642E-2	171	0.028	0.105	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:6exnY	0.095	0.605	3.847E-2	87	0.019	0.138	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
18	PDB:7lmaH	0.097	0.281	5.063E-2	199	0.014	0.045	7lmaH.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
19	PDB:7dvqY	0.096	0.414	5.969E-2	140	0.020	0.093	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:1hl6A	0.100	0.488	9.260E-2	119	0.028	0.151	1hl6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6N8	0.0	996	578	0.776	0.858	A0A0G2K6N8_RAT Poly(A)-specific ribonuclease PARN OS=Rattus norvegicus OX=10116 GN=Parn PE=1 SV=3
2	A0A0G2QC45	0.0	1076	624	0.861	0.881	A0A0G2QC45_RAT Poly(A)-specific ribonuclease PARN OS=Rattus norvegicus OX=10116 GN=Parn PE=2 SV=1
3	A0A494BZU6	0.0	987	488	0.743	0.973	A0A494BZU6_HUMAN Poly(A)-specific ribonuclease PARN (Fragment) OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
4	A0A494BZW7	0.0	1030	499	0.772	0.988	A0A494BZW7_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
5	A0A494C0P9	0.0	1027	524	0.772	0.941	A0A494C0P9_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
6	A0A494C0Q2	0.0	1166	585	0.872	0.952	A0A494C0Q2_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
7	A0A494C0Q6	0.0	1174	581	0.908	0.998	A0A494C0Q6_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
8	A0A494C0W0	0.0	1315	664	1.000	0.962	A0A494C0W0_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
9	A0A494C1K5	0.0	1167	577	0.875	0.969	A0A494C1K5_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
10	A0A494C1N1	0.0	1162	590	0.870	0.942	A0A494C1N1_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
11	A0A8J8Y7Y5	0.0	648	645	0.502	0.498	A0A8J8Y7Y5_RAT Poly(A)-specific ribonuclease PARN OS=Rattus norvegicus OX=10116 GN=Parn PE=1 SV=1
12	O95453	0.0	1330	639	1.000	1.000	PARN_HUMAN Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1
13	Q7ZU92	0.0	821	660	0.664	0.642	PARN_DANRE Poly(A)-specific ribonuclease PARN OS=Danio rerio OX=7955 GN=parn PE=1 SV=2
14	Q8VDG3	0.0	1098	624	0.869	0.889	PARN_MOUSE Poly(A)-specific ribonuclease PARN OS=Mus musculus OX=10090 GN=Parn PE=1 SV=1
15	B2RXZ1	5.53e-45	170	531	0.216	0.260	PNDC1_MOUSE Poly(A)-specific ribonuclease PNLDC1 OS=Mus musculus OX=10090 GN=Pnldc1 PE=1 SV=1
16	H9JAQ7	7.61e-44	167	532	0.227	0.273	TRIMR_BOMMO Pre-piRNA 3'-exonuclease trimmer OS=Bombyx mori OX=7091 GN=PNLDC1 PE=1 SV=2
17	Q9LG26	7.51e-43	166	689	0.219	0.203	PARN_ARATH Poly(A)-specific ribonuclease PARN OS=Arabidopsis thaliana OX=3702 GN=PARN PE=1 SV=2
18	Q8NA58	9.97e-40	155	520	0.205	0.252	PNDC1_HUMAN Poly(A)-specific ribonuclease PNLDC1 OS=Homo sapiens OX=9606 GN=PNLDC1 PE=1 SV=2
19	Q21412	1.12e-26	117	566	0.189	0.214	PARN1_CAEEL 3'-5' exoribonuclease parn-1 OS=Caenorhabditis elegans OX=6239 GN=parn-1 PE=1 SV=2
20	O94386	2.24e-25	111	427	0.175	0.262	YGS9_SCHPO Uncharacterized protein C29A10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A10.09c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04857 CAF1	3e-85	298.0	CAF1 family ribonuclease
2	PF14507 CppA_C	3.4e+02	13.4	CppA C-terminal
3	PF10309 NCBP3	2.3e+02	13.0	Nuclear cap-binding protein subunit 3
4	PF01424 R3H	0.13	23.6	R3H domain
5	PF08675 RNA_bind	1.5e-30	116.3	RNA binding domain
6	PF00076 RRM_1	2.3e+02	13.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
7	PF08487 VIT	5.5e+02	12.1	Vault protein inter-alpha-trypsin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387911

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313007	0.986	Polyadenylate-binding protein 1
2	9606.ENSP00000435926	0.985	CUGBP Elav-like family member 1
3	9606.ENSP00000477715	0.978	Cytoplasmic polyadenylation element-binding protein 1
4	9606.ENSP00000425561	0.975	Eukaryotic translation initiation factor 4E
5	9606.ENSP00000381216	0.972	Far upstream element-binding protein 2
6	9606.ENSP00000373715	0.968	m7GpppN-mRNA hydrolase
7	9606.ENSP00000416255	0.968	Eukaryotic translation initiation factor 4 gamma 1
8	9606.ENSP00000397563	0.951	Poly(A) RNA polymerase GLD2
9	9606.ENSP00000293831	0.941	Eukaryotic initiation factor 4A-I
10	9606.ENSP00000302768	0.941	Polyadenylate-binding protein-interacting protein 1
11	9606.ENSP00000326381	0.934	Eukaryotic initiation factor 4A-II
12	9606.ENSP00000269349	0.928	Eukaryotic initiation factor 4A-III
13	9606.ENSP00000388806	0.913	Eukaryotic translation initiation factor 4B
14	9606.ENSP00000245934	0.909	Symplekin
15	9606.ENSP00000306512	0.903	Interleukin-8
16	9606.ENSP00000323046	0.879	Exosome complex component RRP40
17	9606.ENSP00000376007	0.849	Poly(A)-specific ribonuclease PNLDC1
18	9606.ENSP00000366997	0.840	Exosome complex exonuclease RRP44
19	9606.ENSP00000264951	0.828	5'-3' exoribonuclease 1
20	9606.ENSP00000221233	0.820	Exosome complex component RRP46

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004535	1.000	poly(A)-specific ribonuclease activity
GO:0003730	0.990	mRNA 3'-UTR binding
GO:0070034	0.988	telomerase RNA binding
GO:0019899	0.966	enzyme binding
GO:0019901	0.960	protein kinase binding
GO:0043169	0.941	cation binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0019219	0.992	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0016070	0.987	RNA metabolic process
GO:0048519	0.979	negative regulation of biological process
GO:0048522	0.979	positive regulation of cellular process
GO:0010467	0.968	gene expression
GO:0010556	0.968	regulation of macromolecule biosynthetic process
GO:0031326	0.968	regulation of cellular biosynthetic process
GO:0044260	0.967	cellular macromolecule metabolic process
GO:0048523	0.953	negative regulation of cellular process
GO:0009893	0.951	positive regulation of metabolic process
GO:0043487	0.951	regulation of RNA stability
GO:0010605	0.947	negative regulation of macromolecule metabolic process
GO:0010604	0.943	positive regulation of macromolecule metabolic process
GO:0031324	0.928	negative regulation of cellular metabolic process
GO:0006401	0.927	RNA catabolic process
GO:0051172	0.926	negative regulation of nitrogen compound metabolic process
GO:0031325	0.913	positive regulation of cellular metabolic process
GO:0051173	0.907	positive regulation of nitrogen compound metabolic process
GO:0045935	0.875	positive regulation of nucleobase-containing compound metabolic process
GO:0006396	0.784	RNA processing
GO:0051254	0.784	positive regulation of RNA metabolic process
GO:0031327	0.746	negative regulation of cellular biosynthetic process
GO:0034660	0.699	ncRNA metabolic process
GO:0010558	0.661	negative regulation of macromolecule biosynthetic process
GO:0051246	0.651	regulation of protein metabolic process
GO:0016071	0.638	mRNA metabolic process
GO:0010629	0.630	negative regulation of gene expression
GO:0051128	0.628	regulation of cellular component organization
GO:0051052	0.623	regulation of DNA metabolic process
GO:0033044	0.606	regulation of chromosome organization
GO:0006417	0.591	regulation of translation
GO:1903311	0.562	regulation of mRNA metabolic process
GO:2000278	0.505	regulation of DNA biosynthetic process
GO:0061013	0.426	regulation of mRNA catabolic process
GO:0034470	0.410	ncRNA processing
GO:0045934	0.398	negative regulation of nucleobase-containing compound metabolic process
GO:0006402	0.387	mRNA catabolic process
GO:0000956	0.338	nuclear-transcribed mRNA catabolic process
GO:0043488	0.335	regulation of mRNA stability
GO:0017148	0.330	negative regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016607	0.974	nuclear speck
GO:0005829	0.929	cytosol
GO:0032991	0.882	protein-containing complex
GO:0043228	0.875	non-membrane-bounded organelle
GO:0043232	0.836	intracellular non-membrane-bounded organelle
GO:0005730	0.355	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.13.4	1.000	poly(A)-specific ribonuclease.

[back to server]