StarFunc result for job id O95455

User Input

>input (350 residues)
MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKN
LETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVY
GTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSY
WEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVE
AFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETNSESEMENWVDYVNDRPTNDM
RYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEKALEPFPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95455	1.000	1.000	2.389E-77	350	1.000	1.000	O95455.pdb.gz	TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens OX=9606 GN=TGDS PE=1 SV=1
2	AFDB:Q9SYM5	0.914	0.482	5.351E-47	669	0.454	0.238	Q9SYM5.pdb.gz	RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana OX=3702 GN=RHM1 PE=1 SV=1
3	AFDB:Q9LPG6	0.917	0.485	6.026E-47	667	0.446	0.234	Q9LPG6.pdb.gz	RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana OX=3702 GN=RHM2 PE=1 SV=1
4	AFDB:P26391	0.867	0.842	8.617E-39	361	0.340	0.330	P26391.pdb.gz	RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbB PE=1 SV=1
5	AFDB:P27830	0.880	0.868	9.705E-39	355	0.329	0.324	P27830.pdb.gz	RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rffG PE=1 SV=3
6	PDB:1keuA	0.863	0.838	1.546E-38	361	0.340	0.330	1keuA.pdb.gz	Toward a structural understanding of the dehydratase mechanism.
7	AFDB:P37759	0.871	0.845	1.585E-37	361	0.343	0.332	P37759.pdb.gz	RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfbB PE=3 SV=2
8	AFDB:Q20697	0.844	0.863	3.483E-36	342	0.357	0.365	Q20697.pdb.gz	Q20697_CAEEL NAD(P)-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bus-5 PE=1 SV=1
9	AFDB:Q9HDU4	0.856	0.821	2.475E-35	365	0.343	0.329	Q9HDU4.pdb.gz	YHEB_SCHPO Uncharacterized protein PB2B2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB2B2.11 PE=3 SV=1
10	AFDB:Q59VY4	0.840	0.917	2.788E-35	320	0.320	0.350	Q59VY4.pdb.gz	Q59VY4_CANAL Gal102p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAL102 PE=4 SV=1
11	PDB:1bxkB	0.823	0.836	3.299E-35	344	0.314	0.320	1bxkB.pdb.gz	Molecular Structure of Dtdp-Glucose 4,6-Dehydratase from E. Coli
12	AFDB:P9WN65	0.871	0.920	1.307E-34	331	0.311	0.329	P9WN65.pdb.gz	RMLB_MYCTU dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rmlB PE=1 SV=1
13	PDB:6lttA	0.826	0.926	1.354E-31	311	0.257	0.289	6lttA.pdb.gz
14	PDB:2pk3A	0.776	0.875	4.932E-28	309	0.211	0.239	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
15	PDB:6k0gA	0.799	0.833	5.083E-26	335	0.234	0.245	6k0gA.pdb.gz	Structural basis for broad substrate specificity of UDP-glucose 4-epimerase in the human milk oligosaccharide catabolic pathway of Bifidobacterium longum.
16	PDB:1n7gB	0.814	0.847	5.394E-26	336	0.226	0.235	1n7gB.pdb.gz	The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
17	PDB:4lisA	0.787	0.758	8.677E-26	364	0.231	0.223	4lisA.pdb.gz	Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.
18	PDB:5in4A	0.811	0.800	9.208E-26	355	0.234	0.231	5in4A.pdb.gz	Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
19	PDB:1a9yA	0.807	0.834	1.481E-25	338	0.249	0.257	1a9yA.pdb.gz	Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
20	PDB:1gy8C	0.773	0.735	8.300E-25	370	0.237	0.224	1gy8C.pdb.gz	High-Resolution Crystal Structure of Trypanosoma Brucei Udp-Galactose 4'-Epimerase: A Potential Target for Structure-Based Development of Novel Trypanocides

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95455	0.0	733	350	1.000	1.000	TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens OX=9606 GN=TGDS PE=1 SV=1
2	Q9LPG6	2.29e-103	320	667	0.446	0.234	RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana OX=3702 GN=RHM2 PE=1 SV=1
3	Q9SYM5	5.86e-103	318	669	0.457	0.239	RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana OX=3702 GN=RHM1 PE=1 SV=1
4	Q9LH76	1.13e-102	318	664	0.457	0.241	RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana OX=3702 GN=RHM3 PE=2 SV=1
5	P37759	3.44e-67	217	361	0.337	0.327	RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfbB PE=3 SV=2
6	P27830	6.79e-67	216	355	0.331	0.327	RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rffG PE=1 SV=3
7	Q20697	6.99e-66	213	342	0.371	0.380	Q20697_CAEEL NAD(P)-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bus-5 PE=1 SV=1
8	P26391	2.56e-64	210	361	0.343	0.332	RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbB PE=1 SV=1
9	Q59VY4	3.23e-64	208	320	0.329	0.359	Q59VY4_CANAL Gal102p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAL102 PE=4 SV=1
10	Q9HDU4	1.55e-58	195	365	0.349	0.334	YHEB_SCHPO Uncharacterized protein PB2B2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB2B2.11 PE=3 SV=1
11	A0QSK6	8.28e-57	189	331	0.317	0.335	RMLB_MYCS2 dTDP-glucose 4,6-dehydratase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rmlB PE=1 SV=1
12	P9WN65	1.94e-54	183	331	0.314	0.332	RMLB_MYCTU dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rmlB PE=1 SV=1
13	P9WN67	1.90e-30	119	314	0.266	0.296	GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=galE1 PE=1 SV=1
14	Q9ZV36	1.31e-28	115	343	0.269	0.274	UXS6_ARATH UDP-glucuronic acid decarboxylase 6 OS=Arabidopsis thaliana OX=3702 GN=UXS6 PE=2 SV=1
15	F4KHU8	2.10e-26	109	357	0.263	0.258	F4KHU8_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS3 PE=1 SV=1
16	Q9SN95	2.48e-26	109	341	0.266	0.273	UXS5_ARATH UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana OX=3702 GN=UXS5 PE=2 SV=1
17	Q5PQX0	4.16e-26	110	420	0.266	0.221	UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus OX=10116 GN=Uxs1 PE=1 SV=1
18	Q91XL3	4.37e-26	109	420	0.266	0.221	UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus OX=10090 GN=Uxs1 PE=1 SV=1
19	Q8NBZ7	4.97e-26	109	420	0.266	0.221	UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens OX=9606 GN=UXS1 PE=1 SV=1
20	G5EF65	7.25e-26	109	467	0.269	0.201	G5EF65_CAEEL UDP-glucuronate decarboxylase OS=Caenorhabditis elegans OX=6239 GN=sqv-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	2.3e-23	94.2	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF00106 adh_short	3.2	18.7	short chain dehydrogenase
3	PF01370 Epimerase	2.4e-56	202.5	NAD dependent epimerase/dehydratase family
4	PF16363 GDP_Man_Dehyd	1.7e-69	246.4	GDP-mannose 4,6 dehydratase
5	PF13460 NAD_binding_10	0.17	23.3	NAD(P)H-binding
6	PF07993 NAD_binding_4	1.2e-14	65.7	Male sterility protein
7	PF02719 Polysacc_synt_2	1.4e-23	95.1	Polysaccharide biosynthesis protein
8	PF04321 RmlD_sub_bind	3.6e-20	83.8	RmlD substrate binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261296

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366157	0.853	Integral membrane protein GPR180
2	9606.ENSP00000319501	0.757	UDP-glucose 6-dehydrogenase
3	9606.ENSP00000309092	0.733	Mannose-1-phosphate guanyltransferase beta
4	9606.ENSP00000369519	0.723	S-methyl-5'-thioadenosine phosphorylase
5	9606.ENSP00000238044	0.718	Augurin
6	9606.ENSP00000359127	0.703	Diphthine methyl ester synthase
7	9606.ENSP00000386597	0.667	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
8	9606.ENSP00000322706	0.591	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
9	9606.ENSP00000358414	0.591	Hydroxymethylglutaryl-CoA synthase, mitochondrial
10	9606.ENSP00000382840	0.586	ATP-dependent RNA helicase DDX3X
11	9606.ENSP00000368119	0.581	Galactose-1-phosphate uridylyltransferase
12	9606.ENSP00000289004	0.575	4-hydroxyphenylpyruvate dioxygenase
13	9606.ENSP00000365895	0.570	Heparan-sulfate 6-O-sulfotransferase 3
14	9606.ENSP00000257312	0.568	Zinc finger protein DZIP1
15	9606.ENSP00000483375	0.563	UDP-glucose 4-epimerase
16	9606.ENSP00000316357	0.550	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
17	9606.ENSP00000318318	0.544	Mannose-6-phosphate isomerase
18	9606.ENSP00000338703	0.524	UTP--glucose-1-phosphate uridylyltransferase
19	9606.ENSP00000354532	0.504	Purine nucleoside phosphorylase
20	9606.ENSP00000296412	0.502	Alcohol dehydrogenase class-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.999	catalytic activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.946	nitrogen compound metabolic process
GO:1901360	0.936	organic cyclic compound metabolic process
GO:0044281	0.935	small molecule metabolic process
GO:1901576	0.765	organic substance biosynthetic process
GO:0044249	0.712	cellular biosynthetic process
GO:0046483	0.687	heterocycle metabolic process
GO:0034641	0.658	cellular nitrogen compound metabolic process
GO:1901135	0.606	carbohydrate derivative metabolic process
GO:0006725	0.600	cellular aromatic compound metabolic process
GO:0006139	0.445	nucleobase-containing compound metabolic process
GO:0065007	0.412	biological regulation
GO:0050789	0.385	regulation of biological process
GO:0050794	0.359	regulation of cellular process
GO:0055086	0.353	nucleobase-containing small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043227	0.935	membrane-bounded organelle
GO:0043229	0.873	intracellular organelle
GO:0043231	0.838	intracellular membrane-bounded organelle
GO:0043233	0.356	organelle lumen
GO:0012505	0.338	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]