StarFunc result for job id O95466

User Input

>input (1100 residues)
MGNAAGSAEQPAGPAAPPPKQPAPPKQPMPAAGELEERFNRALNCMNLPPDKVQLLSQYD
NEKKWELICDQERFQVKNPPAAYIQKLKSYVDTGGVSRKVAADWMSNLGFKRRVQESTQV
LRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQCSVTYDMESTDNGASNSEKNKP
LEQSVEDLSKGPPSSVPKSRHLTIKLTPAHSRKALRNSRIVSQKDDVHVCIMCLRAIMNY
QSGFSLVMNHPACVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHDIILAAFDNFKEVC
GEQHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVENMNFRVFLQYEFTHLGLDLYLE
RLRLTESDKLQVQIQAYLDNIFDVGALLEDTETKNAVLEHMEELQEQVALLTERLRDAEN
ESMAKIAELEKQLSQARKELETLRERFSESTAMGPSRRPPEPEKAPPAAPTRPSALELKV
EELEEKGLIRILRGPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPSPDLAPAAEPAPGA
APPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGP
VPPPPPPPPPPPGGPPDALGRRDSELGPGVKAKKPIQTKFRMPLLNWVALKPSQITGTVF
TELNDEKVLQELDMSDFEEQFKTKSQGPSLDLSALKSKAAQKAPSKATLIEANRAKNLAI
TLRKGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLITRFEREQRPMEELSE
EDRFMLCFSRIPRLPERMTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQILEI
VLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVIAEKYPQLTGFHSD
LHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADS
KTAQEAFESVVEYFGENPKTTSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADT
PGKGEPPAPKSPPKARRPQMDLISELKRRQQKEPLIYESDRDGAIEDIITVIKTVPFTAR
TGKRTSRLLCEASLGEEMPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95466	1.000	1.000	0.000	1100	1.000	1.000	O95466.pdb.gz	FMNL1_HUMAN Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3
2	AFDB:Q96PY5	0.365	0.369	2.194E-78	1086	0.591	0.599	Q96PY5.pdb.gz	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
3	AFDB:Q5AL52	0.270	0.179	2.883E-20	1732	0.244	0.155	Q5AL52.pdb.gz	BNI1_CANAL Formin BNI1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNI1 PE=1 SV=1
4	AFDB:Q21227	0.114	0.107	9.211E-3	1188	0.095	0.088	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
5	AFDB:Q9Y6J0	0.072	0.045	1.696E-2	2220	0.129	0.064	Q9Y6J0.pdb.gz	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
6	AFDB:O88387	0.047	0.059	8.301E-2	766	0.062	0.089	O88387.pdb.gz	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
7	AFDB:Q96M96	0.048	0.056	9.769E-2	766	0.065	0.093	Q96M96.pdb.gz	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
8	AFDB:O43432	0.082	0.068	1.353E-1	1585	0.135	0.093	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
9	PDB:7qe7I	0.060	0.081	1.423E-1	742	0.043	0.063	7qe7I.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
10	PDB:5tbkA	0.112	0.240	2.138E-1	417	0.034	0.089	5tbkA.pdb.gz
11	AFDB:A0A024R9Y7	0.042	0.063	2.205E-1	606	0.079	0.144	A0A024R9Y7.pdb.gz
12	PDB:7ajlAAA	0.076	0.191	2.416E-1	290	0.037	0.141	7ajlAAA.pdb.gz
13	PDB:5voxP	0.075	0.154	2.517E-1	462	0.052	0.123	5voxP.pdb.gz
14	PDB:6ahd1	0.088	0.091	2.730E-1	1048	0.045	0.047	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
15	AFDB:P22670	0.059	0.063	3.054E-1	979	0.081	0.091	P22670.pdb.gz	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
16	PDB:6wb92	0.040	0.136	3.085E-1	292	0.042	0.158	6wb92.pdb.gz
17	PDB:6ww7B	0.043	0.111	3.085E-1	281	0.040	0.157	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
18	PDB:6i7sG	0.064	0.076	3.213E-1	863	0.029	0.037	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
19	PDB:4r0zA	0.124	0.221	4.272E-1	557	0.035	0.068	4r0zA.pdb.gz
20	PDB:3tpoA	0.126	0.288	4.450E-1	438	0.038	0.096	3tpoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W1F5	0.0	1105	1027	0.561	0.601	F8W1F5_HUMAN Formin like 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=1
2	K7EJE6	0.0	807	488	0.364	0.820	K7EJE6_HUMAN Formin like 1 (Fragment) OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1
3	K7EK60	0.0	1300	682	0.595	0.959	K7EK60_HUMAN Formin like 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1
4	O95466	0.0	2235	1100	1.000	1.000	FMNL1_HUMAN Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3
5	Q6ZPF4	0.0	1100	1028	0.559	0.598	FMNL3_MOUSE Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2
6	Q8IVF7	0.0	1110	1028	0.561	0.600	FMNL3_HUMAN Formin-like protein 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=3
7	Q96PY5	0.0	1180	1086	0.591	0.599	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
8	Q9JL26	0.0	1786	1094	0.868	0.873	FMNL1_MOUSE Formin-like protein 1 OS=Mus musculus OX=10090 GN=Fmnl1 PE=1 SV=1
9	Q9VUC6	0.0	615	1183	0.335	0.312	FRL_DROME Formin-like protein OS=Drosophila melanogaster OX=7227 GN=Frl PE=1 SV=3
10	Q6NXC0	6.02e-178	551	1047	0.247	0.260	FMNL3_DANRE Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2
11	Q6ZN96	1.37e-170	515	568	0.238	0.461	Q6ZN96_HUMAN cDNA FLJ16308 fis, clone PUAEN2006335 OS=Homo sapiens OX=9606 PE=1 SV=1
12	A0A1D5P556	2.57e-52	202	1075	0.116	0.119	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
13	Q86T65	8.18e-52	201	1068	0.123	0.126	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
14	Q9Y4D1	3.40e-49	192	1078	0.118	0.121	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
15	Q80U19	1.31e-48	191	1115	0.123	0.121	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
16	Q8BPM0	1.86e-47	187	1077	0.110	0.112	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
17	Q8IRY0	1.69e-46	184	1153	0.111	0.106	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
18	Q7YZA4	1.86e-46	184	1114	0.111	0.110	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
19	B3DJI0	2.06e-46	184	1069	0.102	0.105	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
20	M9MSM5	2.24e-46	184	1463	0.111	0.083	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	2.1e+02	12.4	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF20616 Caps_syn_GfcC_N	1.1e+02	14.5	Capsule biosynthesis GfcC, N-terminal
3	PF10607 CTLH	1.6e+02	13.6	CTLH/CRA C-terminal to LisH motif domain
4	PF06367 Drf_FH3	2.8e-35	133.3	Diaphanous FH3 Domain
5	PF06371 Drf_GBD	4.3e-23	93.4	Diaphanous GTPase-binding Domain
6	PF08855 DUF1825	2.4e+02	13.1	Domain of unknown function (DUF1825)
7	PF13870 DUF4201	2e+02	13.1	Domain of unknown function (DUF4201)
8	PF14362 DUF4407	8.3e+02	10.6	Domain of unknown function (DUF4407)
9	PF02181 FH2	2.8e-101	351.0	Formin Homology 2 Domain
10	PF05130 FlgN	1.8e+02	14.0	FlgN protein
11	PF14282 FlxA	1e+02	14.4	FlxA-like protein
12	PF01608 I_LWEQ	1.5e+02	13.9	I/LWEQ domain
13	PF05859 Mis12	7.4e+02	11.6	Mis12 protein
14	PF05929 Phage_GPO	6.4e+02	11.3	Phage capsid scaffolding protein (GPO) serine peptidase
15	PF07072 ZapD	3.9e+02	12.2	Cell division protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.943	Cell division control protein 42 homolog
2	9606.ENSP00000225655	0.928	Profilin-1
3	9606.ENSP00000239940	0.928	Profilin-2
4	9606.ENSP00000348461	0.886	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000296145	0.845	Teratocarcinoma-derived growth factor 1
6	9606.ENSP00000459615	0.841	SLIT-ROBO Rho GTPase-activating protein 2
7	9606.ENSP00000259216	0.815	Cryptic protein
8	9606.ENSP00000400175	0.803	Transforming protein RhoA
9	9606.ENSP00000349960	0.781	Actin, cytoplasmic 1
10	9606.ENSP00000458162	0.781	Actin, cytoplasmic 2
11	9606.ENSP00000322170	0.741	Profilin-4
12	9606.ENSP00000451828	0.733	RAC-alpha serine/threonine-protein kinase
13	9606.ENSP00000365891	0.727	Wiskott-Aldrich syndrome protein
14	9606.ENSP00000367220	0.709	Actin-related protein 2
15	9606.ENSP00000452746	0.698	Proline-serine-threonine phosphatase-interacting protein 1
16	9606.ENSP00000387261	0.679	Proline-serine-threonine phosphatase-interacting protein 2
17	9606.ENSP00000285735	0.676	Rho-related GTP-binding protein RhoC
18	9606.ENSP00000268182	0.660	Ras GTPase-activating-like protein IQGAP1
19	9606.ENSP00000249071	0.659	Ras-related C3 botulinum toxin substrate 2
20	9606.ENSP00000359000	0.655	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032794	1.000	GTPase activating protein binding
GO:0008092	0.669	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.987	regulation of biological process
GO:0071840	0.977	cellular component organization or biogenesis
GO:0016043	0.972	cellular component organization
GO:0030029	0.957	actin filament-based process
GO:0006996	0.941	organelle organization
GO:0007010	0.924	cytoskeleton organization
GO:0030036	0.911	actin cytoskeleton organization
GO:0050794	0.719	regulation of cellular process
GO:0008360	0.699	regulation of cell shape
GO:0030865	0.463	cortical cytoskeleton organization
GO:0030866	0.359	cortical actin cytoskeleton organization
GO:0048518	0.354	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	0.999	vesicle
GO:0005829	0.999	cytosol
GO:0043229	0.996	intracellular organelle
GO:0005886	0.996	plasma membrane
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005576	0.978	extracellular region
GO:0070062	0.951	extracellular exosome
GO:0031410	0.637	cytoplasmic vesicle
GO:0043232	0.527	intracellular non-membrane-bounded organelle
GO:0005634	0.348	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]