StarFunc result for job id O95475

User Input

>input (246 residues)
MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIV
AFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP
LPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR
QRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSS
DSECDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95475	1.000	1.000	1.556E-36	246	1.000	1.000	O95475.pdb.gz	SIX6_HUMAN Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=SIX6 PE=1 SV=2
2	AFDB:O73708	0.703	0.601	4.277E-31	294	0.809	0.677	O73708.pdb.gz	O73708_DANRE Homeobox protein SIX3 OS=Danio rerio OX=7955 GN=six3 PE=2 SV=1
3	AFDB:Q9ET75	0.702	0.533	9.922E-30	337	0.813	0.593	Q9ET75.pdb.gz	Q9ET75_RAT Homeobox protein Six3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=1 SV=1
4	AFDB:O73709	0.818	0.692	4.084E-29	293	0.768	0.645	O73709.pdb.gz	O73709_DANRE Homeobox protein Six6 OS=Danio rerio OX=7955 GN=SIX3 PE=2 SV=1
5	AFDB:O93282	0.777	0.748	2.316E-26	256	0.699	0.672	O93282.pdb.gz	O93282_DANRE Homeobox protein Six7 OS=Danio rerio OX=7955 GN=six7 PE=2 SV=1
6	AFDB:Q95RW8	0.772	0.402	2.324E-25	487	0.687	0.347	Q95RW8.pdb.gz	OPTIX_DROME Protein Optix OS=Drosophila melanogaster OX=7227 GN=Optix PE=2 SV=1
7	AFDB:O73916	0.798	0.725	3.353E-25	272	0.671	0.607	O73916.pdb.gz	SIX3_ORYLA Homeobox protein SIX3 OS=Oryzias latipes OX=8090 GN=six3 PE=1 SV=1
8	AFDB:Q98TH1	0.750	0.647	3.936E-24	288	0.565	0.483	Q98TH1.pdb.gz	Q98TH1_DANRE Homeobox protein SIX2 OS=Danio rerio OX=7955 GN=six2.1 PE=2 SV=1
9	AFDB:Q62232	0.692	0.587	1.314E-23	296	0.565	0.470	Q62232.pdb.gz	SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus OX=10090 GN=Six2 PE=1 SV=2
10	AFDB:G3V970	0.699	0.614	2.219E-23	284	0.549	0.475	G3V970.pdb.gz	G3V970_RAT SIX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Six1 PE=3 SV=1
11	PDB:4egcA	0.454	0.209	5.850E-18	539	0.480	0.219	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.177	0.527	1.579E-1	73	0.077	0.260	2hi3A.pdb.gz
13	PDB:2c2lA	0.186	0.168	1.754E-1	281	0.102	0.089	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
14	PDB:4cr2T	0.278	0.256	2.667E-1	272	0.106	0.096	4cr2T.pdb.gz	Deep Classification of a Large Cryo-Em Dataset Defines the Conformational Landscape of the 26S Proteasome.
15	PDB:7dkhI	0.311	0.116	6.500E-1	914	0.138	0.037	7dkhI.pdb.gz
16	PDB:7qe7Y	0.189	0.110	6.500E-1	502	0.114	0.056	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:4m57A	0.241	0.106	7.606E-1	702	0.126	0.044	4m57A.pdb.gz
18	PDB:7kw7E	0.281	0.223	7.606E-1	327	0.085	0.064	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
19	PDB:1tqdB	0.114	0.085	8.015E-1	379	0.077	0.050	1tqdB.pdb.gz
20	PDB:5w5iC	0.226	0.153	8.015E-1	436	0.110	0.062	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95475	0.0	510	246	1.000	1.000	SIX6_HUMAN Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=SIX6 PE=1 SV=2
2	Q9QZ28	0.0	502	246	0.980	0.980	SIX6_MOUSE Homeobox protein SIX6 OS=Mus musculus OX=10090 GN=Six6 PE=1 SV=2
3	Q7T3G8	5.64e-158	439	245	0.907	0.910	Q7T3G8_DANRE Homeobox protein SIX6 OS=Danio rerio OX=7955 GN=Six6 PE=2 SV=1
4	Q5TYZ2	3.33e-150	420	245	0.911	0.914	Q5TYZ2_DANRE SIX homeobox 6b OS=Danio rerio OX=7955 GN=zgc:110344 PE=2 SV=1
5	O73708	7.43e-141	398	294	0.809	0.677	O73708_DANRE Homeobox protein SIX3 OS=Danio rerio OX=7955 GN=six3 PE=2 SV=1
6	A0A0G2K2C0	5.53e-140	398	344	0.813	0.581	A0A0G2K2C0_RAT SIX homeobox 3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=3 SV=2
7	O95343	6.45e-140	397	332	0.813	0.602	SIX3_HUMAN Homeobox protein SIX3 OS=Homo sapiens OX=9606 GN=SIX3 PE=1 SV=1
8	Q9ET75	7.03e-140	397	337	0.813	0.593	Q9ET75_RAT Homeobox protein Six3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=1 SV=1
9	Q62233	7.45e-140	397	333	0.813	0.601	SIX3_MOUSE Homeobox protein SIX3 OS=Mus musculus OX=10090 GN=Six3 PE=1 SV=2
10	A0A8I6G4X0	1.44e-139	397	358	0.813	0.559	A0A8I6G4X0_RAT SIX homeobox 3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=3 SV=1
11	A0A0G2JWI0	2.69e-132	379	350	0.785	0.551	A0A0G2JWI0_RAT SIX homeobox 3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=3 SV=2
12	A0A8I6A1B9	5.82e-132	378	356	0.785	0.542	A0A8I6A1B9_RAT SIX homeobox 3 OS=Rattus norvegicus OX=10116 GN=Six3 PE=3 SV=1
13	O73709	6.48e-130	370	293	0.768	0.645	O73709_DANRE Homeobox protein Six6 OS=Danio rerio OX=7955 GN=SIX3 PE=2 SV=1
14	O93282	1.34e-117	338	256	0.699	0.672	O93282_DANRE Homeobox protein Six7 OS=Danio rerio OX=7955 GN=six7 PE=2 SV=1
15	O73916	2.53e-108	315	272	0.675	0.610	SIX3_ORYLA Homeobox protein SIX3 OS=Oryzias latipes OX=8090 GN=six3 PE=1 SV=1
16	Q95RW8	6.31e-103	309	487	0.659	0.333	OPTIX_DROME Protein Optix OS=Drosophila melanogaster OX=7227 GN=Optix PE=2 SV=1
17	Q98TH1	8.20e-99	291	288	0.569	0.486	Q98TH1_DANRE Homeobox protein SIX2 OS=Danio rerio OX=7955 GN=six2.1 PE=2 SV=1
18	Q62232	1.03e-95	284	296	0.533	0.443	SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus OX=10090 GN=Six2 PE=1 SV=2
19	Q6NZ04	1.27e-95	283	284	0.533	0.461	SIX1B_DANRE Homeobox protein six1b OS=Danio rerio OX=7955 GN=six1b PE=1 SV=1
20	Q9NPC8	1.50e-95	283	291	0.533	0.450	SIX2_HUMAN Homeobox protein SIX2 OS=Homo sapiens OX=9606 GN=SIX2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15814 FAM199X	86	13.7	Protein family FAM199X
2	PF05920 Homeobox_KN	2.4e-07	41.9	Homeobox KN domain
3	PF00046 Homeodomain	1.4e-09	48.9	Homeodomain
4	PF01381 HTH_3	85	14.6	Helix-turn-helix
5	PF16878 SIX1_SD	1.3e-45	165.9	Transcriptional regulator, SIX1, N-terminal SD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000057584

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000042753	0.775	Uncharacterized protein
2	9598.ENSPTRP00000036487	0.753	Uncharacterized protein
3	9598.ENSPTRP00000010068	0.745	Uncharacterized protein
4	9598.ENSPTRP00000021982	0.721	Uncharacterized protein
5	9598.ENSPTRP00000011084	0.715	Uncharacterized protein
6	9598.ENSPTRP00000054548	0.702	Potential transcription factor. May play a role in early mesoderm formation and later in lateral mesoderm differentiation and neurogenesis (By similarity)
7	9598.ENSPTRP00000010875	0.677	Uncharacterized protein
8	9598.ENSPTRP00000017091	0.677	Uncharacterized protein
9	9598.ENSPTRP00000010823	0.657	Uncharacterized protein
10	9598.ENSPTRP00000030361	0.643	Geminin, DNA replication inhibitor
11	9598.ENSPTRP00000040179	0.643	Uncharacterized protein
12	9598.ENSPTRP00000000739	0.638	Eyes absent homolog
13	9598.ENSPTRP00000031782	0.636	Eyes absent homolog
14	9598.ENSPTRP00000034805	0.636	Eyes absent homolog
15	9598.ENSPTRP00000050204	0.625	Ventral anterior homeobox 1
16	9598.ENSPTRP00000009320	0.574	Uncharacterized protein
17	9598.ENSPTRP00000010200	0.570	Uncharacterized protein
18	9598.ENSPTRP00000012367	0.557	Uncharacterized protein
19	9598.ENSPTRP00000035973	0.557	Transducin-like enhancer of split 4
20	9598.ENSPTRP00000045296	0.557	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	0.909	DNA-binding transcription factor activity
GO:0008134	0.668	transcription factor binding
GO:0000981	0.625	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0050789	0.933	regulation of biological process
GO:0050794	0.919	regulation of cellular process
GO:0048513	0.910	animal organ development
GO:0009653	0.883	anatomical structure morphogenesis
GO:0007600	0.742	sensory perception
GO:0009987	0.741	cellular process
GO:0007275	0.738	multicellular organism development
GO:0050953	0.714	sensory perception of light stimulus
GO:0048731	0.665	system development
GO:0019222	0.657	regulation of metabolic process
GO:0060255	0.635	regulation of macromolecule metabolic process
GO:0019219	0.616	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.591	regulation of gene expression
GO:0009889	0.586	regulation of biosynthetic process
GO:0006355	0.579	regulation of DNA-templated transcription
GO:0048522	0.326	positive regulation of cellular process
GO:0007601	0.315	visual perception

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.971	intracellular organelle lumen
GO:0005654	0.953	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]